Recombinant Human Protein Phosphatase 1A Alpha Isoform | MyBioSource MBS142768 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Protein Phosphatase 1A Alpha Isoform

catalog :

MBS142768

quantity :

0.01 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS142768

products type :

Recombinant Protein

products full name :

Recombinant Human Protein Phosphatase 1A Alpha Isoform

products short name :

Phosphatase 1A Alpha

products name syn :

PPM1A Human; Protein Phosphatase 1A Alpha Isoform Human Recombinant; Protein phosphatase 1A; EC 3.1.3.16; Protein phosphatase 2C isoform alpha; PP2C-alpha; IA; PPM1A; PP2CA; MGC9201

other names :

protein phosphatase 1A isoform 1; Protein phosphatase 1A; protein phosphatase 1A; protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform; protein phosphatase, Mg2+/Mn2+ dependent, 1A; Protein phosphatase 2C isoform alpha; PP2C-alpha; Protein phosphatase IA

products gene name :

PPM1A

other gene names :

PPM1A; PPM1A; PP2CA; PP2Calpha; PP2C-ALPHA; PPPM1A; PP2C-alpha

uniprot entry name :

PPM1A_HUMAN

host :

E Coli

sequence length :

382

sequence :

AQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAG SQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTG FLEIDEHMRV MSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDH KPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQL VSPEPEVHDI ERSEEDDQFI ILACDGIWDVMGNEELCDFVRSRLEVTDDL EKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLEC RVEEIIKKQG EGVPDLVHVM RTLASENIPSLPPGGELASKRNVIEAVYNR LNPYKNDDTDSTSTDDMW.
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWILMGA
FLDKPKMEKHN

purity :

Greater than 95.0% as determined by(a)Analysis by RP-HPLC. (b)Analysis by SDS-PAGE.

form :

The protein (1mg/ml) In phosphate-buffered saline (pH 7.4). Sterile filtered colorless solution.

storage stability :

Store at 4 degree C if entire vial will be used within 2-4 weeks. Store, frozen at -20 degree C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.

other info1 :

Unit Defenition: One unit will hydrolyze 1nanomole of p-nitrophenylphosphatate per minute at pH 7.4 at 37 degree C using 10mM of substrate.

other info2 :

Activity: 8,000 U/mg.

products categories :

PROTEIN KINASES; Enzymes; Phosphatase

products description :

Description: Protein Phosphatase 1A Alpha Isoform Human Recombinant produced is a single, non-glycosylated polypeptide chain containing 382 amino acids and having a molecular mass of 46.6KDa (containing His tag, T7 gene 10 leader, XpressTM Epitope). The protein coding region of PP2Calpha (amino acids 1-382) was cloned into an E Coli expression vector. PPM1A was overexpressed in E Coli as a soluble His-tag fusion protein, and it was purified by conventional column chromatographic techniques. Introduction: Protein Phosphatase 2C alpha is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to activate the expression of the tumor suppressor gene TP53/p53, which leads to G2/M cell cycle arrest and apoptosis. Three alternatively spliced transcript variants encoding two distinct isoforms have been described.Protein phosphatase 2C(PP2C?) is a Mn2+- or Mg2+-dependent protein serine/threonine phosphatase that is essential for regulating cellular stress response in eukaryotes.

ncbi gi num :

10337595

ncbi acc num :

NP_066283.1

ncbi gb acc num :

NM_021003.4

uniprot acc num :

P35813

ncbi mol weight :

51,366 Da

ncbi pathways :

BMP Receptor Signaling Pathway (137948); Disease Pathway (530764); Downregulation Of SMAD2/3:SMAD4 Transcriptional Activity Pathway (645266); Energy Dependent Regulation Of MTOR By LKB1-AMPK Pathway (160972); Gene Expression Pathway (105937); Generic Transcription Pathway (105938); IGF1R Signaling Cascade Pathway (730346); IRS-mediated Signalling Pathway (106426); IRS-related Events Pathway (106424); IRS-related Events Triggered By IGF1R Pathway (730348)

ncbi summary :

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to activate the expression of the tumor suppressor gene TP53/p53, which leads to G2/M cell cycle arrest and apoptosis. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

uniprot summary :

PPPM1A: a Ser/Thr protein phosphatase of the PP2C family. Inhibits the activation of p38 and JNK kinase cascades induced by environmental stresses. Can also dephosphorylate cyclin-dependent kinases and may play a role in cell cycle control. Overexpression of this phosphatase activates the expression of p53, leading to G2/M cell cycle arrest and apoptosis. Protein type: Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; EC 3.1.3.16. Chromosomal Location of Human Ortholog: 14q23.1. Cellular Component: nucleoplasm; neuron projection; membrane; voltage-gated calcium channel complex; nucleus; cytosol. Molecular Function: protein C-terminus binding; protein binding; signal transducer activity; calmodulin-dependent protein phosphatase activity; manganese ion binding; magnesium ion binding; protein serine/threonine phosphatase activity. Biological Process: N-terminal protein myristoylation; transcription initiation from RNA polymerase II promoter; positive regulation of I-kappaB kinase/NF-kappaB cascade; Wnt receptor signaling pathway; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; negative regulation of NF-kappaB import into nucleus; negative regulation of transcription from RNA polymerase II promoter; negative regulation of I-kappaB kinase/NF-kappaB cascade; protein amino acid dephosphorylation; dephosphorylation; transforming growth factor beta receptor signaling pathway; insulin receptor signaling pathway; gene expression; cell cycle arrest; negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of Wnt receptor signaling pathway

size1 :

0.01 mg

price1 :

140 USD

size2 :

0.05 mg

price2 :

205

size3 :

1 mg

price3 :

1790

more info or order :

MyBioSource product webpage