protein

Recombinant Human Follicle Stimulating Hormone

MBS142647

0.01 mg

205 USD

Recombinant Protein

Recombinant Human Follicle Stimulating Hormone

Follicle Stimulating Hormone

FSH Human; Follicle Stimulating Hormone Human Recombinant; Follitropin subunit beta; Follicle-stimulating hormone beta subunit; FSH-beta; FSH-B; Follitropin beta chain; FSH

follitropin subunit beta; Follitropin subunit beta; follitropin subunit beta; FSH-B; FSH-beta; follicle-stimulating hormone beta subunit; follitropin beta chain; follitropin, beta chain; follicle stimulating hormone, beta polypeptide; Follicle-stimulating hormone beta subunit; FSH-B; FSH-beta; Follitropin beta chain

FSH

FSHB; FSHB; FSH-B; FSH-beta

FSHB_HUMAN

HEK293

129

FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPT
PLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVEN
HTACHCSTCYYHKS.
FSH subunit alpha:

Greater than 95% as determined by SDS-PAGE.

The recombinant FSH was lyophilized from a concentrated (1mg/ml) solution containing PBS. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution FSH should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.

HORMONES; Hormones; FSH

Description: FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Met1-Ser116) and human FSH-beta chain(Accession # P01225) (Met1-Glu129) having a total Mw of 38kDa.FSH human recombinant is purified by proprietary chromatographic techniques. Introduction: Follicle stimulating hormone (FSH) is a hormone synthesised and secreted by gonadotropes in the anterior pituitary gland. FSH and LH act synergistically in reproduction: In women, in the ovary FSH stimulates the growth of immature Graafian follicles to maturation. As the follicle grows it releases inhibin, which shuts off the FSH production. In men, FSH enhances the production of androgen-binding protein by the Sertoli cells of the testes and is critical for spermatogenesis. In both males and females, FSH stimulates the maturation of germ cells. In females, FSH initiates follicular growth, specifically affecting granulosa cells. With the concomitant rise in inhibin B FSH levels then decline in the late follicular phase. This seems to be critical in selecting only the most advanced follicle to proceed to ovulation. At the end of the luteal phase, there is a slight rise in FSH that seems to be of importance to start the next ovulatory cycle. Like its partner, LH, FSH release at the pituitary gland is controlled by pulses of gonadotropin-releasing hormone (GnRH). Those pulses, in turn, are subject to the estrogen feed-back from the gonads.

4503791

NP_000501.1

NM_000510.2

P01225

14,700 Da

Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway 1127664!!Disease Pathway 530764!!FSH Signaling Pathway 672455!!G Alpha (s) Signalling Events Pathway 119549!!GPCR Downstream Signaling Pathway 119548!!GPCR Ligand Binding Pathway 161020!!Glycoprotein Hormones Pathway 160989!!GnRH Signaling Pathway 83091!!GnRH Signaling Pathway 502

The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

0.01 mg

205 USD