Recombinant Human Secreted Phospholipase A2-X | MyBioSource MBS142470 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Secreted Phospholipase A2-X

catalog :

MBS142470

quantity :

0.002 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS142470

products type :

Recombinant Protein

products full name :

Recombinant Human Secreted Phospholipase A2-X

products short name :

Secreted Phospholipase A2-X

products name syn :

PLA2G10 Human; Secreted Phospholipase A2-X Human Recombinant; Group 10 secretory phospholipase A2; EC 3.1.1.4; Group X secretory phospholipase A2; Phosphatidylcholine 2-acylhydrolase GX; GX sPLA2; sPLA2-X; SPLA2; GXPLA2; MGC119918; MGC119919; MGC133367; PLA2G10

other names :

group 10 secretory phospholipase A2; Group 10 secretory phospholipase A2; group 10 secretory phospholipase A2; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; sPLA2-X; phospholipase A2, group X; Group X secretory phospholipase A2; GX sPLA2; sPLA2-X; Phosphatidylcholine 2-acylhydrolase 10

products gene name :

PLA2G10

other gene names :

PLA2G10; PLA2G10; SPLA2; GXPLA2; GXSPLA2; GX sPLA2; sPLA2-X

uniprot entry name :

PA2GX_HUMAN

host :

E Coli

sequence length :

165

purity :

Greater than 95% as determined by SDS PAGE.

form :

Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2. Sterile Filtered lyophilized (freeze-dried) powder.

storage stability :

Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.

other info2 :

Solubility: Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.

products categories :

ENZYMES; Enzymes; Secreted Phospholipase A2

products description :

Introduction: Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
(underlined).MRGSHHHHHHGMASHMGILELAGTVG
CVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCC
YTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLC
KCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag

ncbi gi num :

4505845

ncbi acc num :

NP_003552.1

ncbi gb acc num :

NM_003561.1

uniprot acc num :

O15496

ncbi mol weight :

18,153 Da

ncbi pathways :

Acyl Chain Remodelling Of PC Pathway (645321); Acyl Chain Remodelling Of PE Pathway (645317); Acyl Chain Remodelling Of PG Pathway (645328); Acyl Chain Remodelling Of PI Pathway (645326); Acyl Chain Remodelling Of PS Pathway (645324); Arachidonic Acid Metabolism Pathway (82991); Arachidonic Acid Metabolism Pathway (366); Ether Lipid Metabolism Pathway (82990); Ether Lipid Metabolism Pathway (365); Fat Digestion And Absorption Pathway (194385)

uniprot summary :

PLA2G10: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine. Belongs to the phospholipase A2 family. Protein type: Secreted; Lipid Metabolism - arachidonic acid; Secreted, signal peptide; Cell development/differentiation; Lipid Metabolism - ether lipid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - linoleic acid; Phospholipase; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 16p13.1-p12. Cellular Component: extracellular region. Molecular Function: phospholipase A2 activity; calcium ion binding; phospholipase activity. Biological Process: axon guidance; cholesterol homeostasis; phospholipid metabolic process; negative regulation of transcription factor activity; regulation of macrophage activation; lysophospholipid transport; positive regulation of cellular protein metabolic process; glycerophospholipid biosynthetic process; positive regulation of prostaglandin secretion; phosphatidic acid biosynthetic process; arachidonic acid metabolic process; lipid catabolic process

size1 :

0.002 mg

price1 :

140 USD

size2 :

0.01 mg

price2 :

205

size3 :

1 mg

price3 :

4140

more info or order :

MyBioSource product webpage