Recombinant Human Secreted Phospholipase A2-IIE | MyBioSource MBS142468 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Secreted Phospholipase A2-IIE

catalog :

MBS142468

quantity :

0.002 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS142468

products type :

Recombinant Protein

products full name :

Recombinant Human Secreted Phospholipase A2-IIE

products short name :

Secreted Phospholipase A2-IIE

products name syn :

PLA2G2E Human; Secreted Phospholipase A2-IIE Human Recombinant; Group IIE secretory phospholipase A2; EC 3.1.1.4; Phosphatidylcholine 2-acylhydrolase GIIE; GIIE sPLA2; sPLA(2)-IIE; sPLA2-IIE; PLA2G2E

other names :

group IIE secretory phospholipase A2; Group IIE secretory phospholipase A2; group IIE secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 2E; phospholipase A2, group IIE; Phosphatidylcholine 2-acylhydrolase 2E

products gene name :

PLA2G2E

other gene names :

PLA2G2E; PLA2G2E; sPLA2-IIE; GIIE sPLA2; GIIE sPLA2; sPLA2-IIE

uniprot entry name :

PA2GE_HUMAN

host :

E Coli

sequence length :

142

specificity :

The amino acid sequence of the recombinant human Secreted Phospholipase A2-IIE is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IIE without signal sequence.

purity :

Greater than 95% as determined by SDS PAGE. Ni-NTA affinity chromatography.

form :

Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4. Sterile Filtered lyophilized (freeze-dried) powder.

storage stability :

Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.

other info2 :

Solubility: Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 ug/ml. In higher concentrations the solubility of this antigen is limited.

products categories :

ENZYMES; Enzymes; Secreted Phospholipase A2

products description :

Introduction: Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
(underlined).MRGSHHHHHHGMASHMNLVQFGVMIE
KMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCC
YGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCE
CDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.
Description: Secreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues His-Tag

ncbi gi num :

7657461

ncbi acc num :

NP_055404.1

ncbi gb acc num :

NM_014589.2

uniprot acc num :

Q9NZK7

ncbi mol weight :

15,989 Da

ncbi pathways :

Acyl Chain Remodelling Of PC Pathway (645321); Acyl Chain Remodelling Of PE Pathway (645317); Acyl Chain Remodelling Of PG Pathway (645328); Acyl Chain Remodelling Of PI Pathway (645326); Acyl Chain Remodelling Of PS Pathway (645324); Arachidonic Acid Metabolism Pathway (82991); Arachidonic Acid Metabolism Pathway (366); Ether Lipid Metabolism Pathway (82990); Ether Lipid Metabolism Pathway (365); Fat Digestion And Absorption Pathway (194385)

uniprot summary :

PLA2G2E: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a preference for arachidonic-containing phospholipids. Belongs to the phospholipase A2 family. Protein type: Phospholipase; Secreted, signal peptide; Lipid Metabolism - linoleic acid; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Lipid Metabolism - arachidonic acid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - ether lipid; Secreted. Chromosomal Location of Human Ortholog: 1p36.13. Cellular Component: extracellular region. Molecular Function: phospholipase A2 activity; calcium ion binding. Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; inflammatory response; lipid catabolic process

size1 :

0.002 mg

price1 :

140 USD

size2 :

0.01 mg

price2 :

205

size3 :

1 mg

price3 :

4140

more info or order :

MyBioSource product webpage