Recombinant Human Paraoxonase-2 | MyBioSource MBS142441 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Paraoxonase-2

catalog :

MBS142441

quantity :

0.002 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS142441

products type :

Recombinant Protein

products full name :

Recombinant Human Paraoxonase-2

products short name :

Paraoxonase-2

products name syn :

PON2 Human; Paraoxonase-2 Human Recombinant; Serum paraoxonase; arylesterase 2; EC 3.1.1.2; EC 3.1.8.1; PON 2; Serum aryldialkylphosphatase 2; A-esterase 2; Aromatic esterase 2

other names :

serum paraoxonase/arylesterase 2 isoform 1; Serum paraoxonase/arylesterase 2; serum paraoxonase/arylesterase 2; A-esterase 2; PON 2; aromatic esterase 2; paraoxonase nirs; serum aryldialkylphosphatase 2; paraoxonase 2; Aromatic esterase 2; A-esterase 2; Serum aryldialkylphosphatase 2

products gene name :

PON2

other gene names :

PON2; PON2; PON 2; A-esterase 2

uniprot entry name :

PON2_HUMAN

host :

E Coli

sequence length :

354

sequence :

ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVY DGKLLIGTLYHRALYCELZ.
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDL
PHCHLIKGIEAGSEDID

purity :

Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.

form :

PON2 is supplied in PBS and 50% glycerol. Sterile Filtered clear solution.

concentration :

10ug/100ul

storage stability :

Store at 4 degree C if entire vial will be used within 1-2 weeks. Store, frozen at -20 degree C for longer periods of time. Avoid multiple freeze-thaw cycles.

tested application :

Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)

app notes :

Arylesterase 2 can be used directly as a positive control in Western blotting, ELISA, immunoprecipitation and other immunological experiments. The biological activity of this product has not yet been tested.

products categories :

ENZYMES; Enzymes; Paraoxonase

products description :

Description: Paraoxonase-2 Human Recombinant is expressed in E Coli having a molecular weight of 43.5 kDa and fused to an amino terminal hexahistidine tag.The PON2 purified by proprietary chromatographic techniques. Introduction: Paraoxonase 2 (PON2) is a member of a multigene family whose genes share 65% identity at the amino acid level, and is expressed in a variety of tissues, including the pancreas. PON2 overexpression has been shown to lower the intracellular oxidative state and reduce the cells ability to oxidize LDL. PON2 is therefore implicated in the modulation of oxidative stress.

ncbi gi num :

66529294

ncbi acc num :

NP_000296.2

ncbi gb acc num :

NM_000305.2

uniprot acc num :

Q15165

ncbi mol weight :

37,996 Da

ncbi pathways :

Metabolic Pathways (132956); Phase I, Non P450 Pathway (198854)

ncbi summary :

This gene encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded protein may also play a role in defense responses to pathogenic bacteria. Mutations in this gene may be associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

uniprot summary :

PON2: Capable of hydrolyzing lactones and a number of aromatic carboxylic acid esters. Has antioxidant activity. Is not associated with high density lipoprotein. Prevents LDL lipid peroxidation, reverses the oxidation of mildly oxidized LDL, and inhibits the ability of MM-LDL to induce monocyte chemotaxis. Belongs to the paraoxonase family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: EC 3.1.1.81; Motility/polarity/chemotaxis; EC 3.1.1.2; Hydrolase. Chromosomal Location of Human Ortholog: 7q21.3. Cellular Component: mitochondrion; lysosome; extracellular region; plasma membrane; nucleus. Molecular Function: identical protein binding; arylesterase activity; metal ion binding. Biological Process: response to oxidative stress; aromatic compound catabolic process

size1 :

0.002 mg

price1 :

140 USD

size2 :

0.01 mg

price2 :

205

size3 :

1 mg

price3 :

4960

more info or order :

MyBioSource product webpage