MyBioSource

protein

Recombinant Human Interleukin-13

MBS142322

0.01 mg

205 USD

MBS142322

Recombinant Protein

Recombinant Human Interleukin-13

Interleukin-13

IL 13 Human; Interleukin-13 Human Recombinant; NC30; ALRH; BHR1; P600; IL-13; MGC116786; MGC116788; MGC116789

interleukin-13; Interleukin-13; interleukin-13; interleukin 13; N/A

IL-13

IL13; IL13; P600; IL-13; NC30; IL-13

IL13_HUMAN

E Coli

146

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLT
AGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ
FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.

Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution IL13 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Protein Content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.57 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IL-13 as a Reference Standard. Biological Activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be 1 x 106units/mg.

CYTOKINES AND GROWTH FACTORS; Cytokines; Interleukin

Description: Interleukin-13 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques. Introduction: IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

26787978

NP_002179.2

NM_002188.2

P35225

15,816 Da

Asthma Pathway 83120!!Asthma Pathway 532!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Cytokines And Inflammatory Response Pathway 198794!!Fc Epsilon RI Signaling Pathway 83082!!Fc Epsilon RI Signaling Pathway 493!!Glucocorticoid Receptor Regulatory Network Pathway 138014!!IL12 Signaling Mediated By STAT4 Pathway 137936!!Inflammatory Bowel Disease (IBD) Pathway 842771

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008]

0.01 mg

205 USD