protein

Recombinant Human Pro-Nerve Growth Factor

MBS142302

0.002 mg

140 USD

Recombinant Protein

Recombinant Human Pro-Nerve Growth Factor

Pro-Nerve Growth Factor

ProNGF Human; Pro-Nerve Growth Factor Human Recombinant; Human Pro-NGF; ProNGF; NGFB

beta-nerve growth factor; Beta-nerve growth factor; beta-nerve growth factor; nerve growth factor, beta subunit; nerve growth factor (beta polypeptide)

ProNGF

NGF; NGF; NGFB; HSAN5; Beta-NGF; NGFB; Beta-NGF

NGF_HUMAN

E Coli

241

MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPA
AAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPR
EAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFS
VCDSVSVWVGKTTATDIKGKEVMVLGEVNINNSVFKQYF
FETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTM
DGKQAAWRFIRIDTACVCVLSRKAVRRA.

Greater than 95.0% as determined by SDS-PAGE.

ProNGF was lyophilized from a 0.2 uM filtered solution of 20mM PB and 250mM NaCl pH 7.2. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution ProNGF should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

CYTOKINES AND GROWTH FACTORS; Neurotrophins; Beta-Nerve Growth Factor

Description: Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.

70995319

NP_002497.2

NM_002506.2

P01138

26,959 Da

ARMS-mediated Activation Pathway (106466); Activation Of TRKA Receptors Pathway (106456); Apoptosis Pathway (83060); Apoptosis Pathway (470); Axonal Growth Stimulation Pathway (106453); BDNF Signaling Pathway (712093); Cell Death Signalling Via NRAGE, NRIF And NADE Pathway (106443); Ceramide Signalling Pathway (106451); Frs2-mediated Activation Pathway (106465); Id Signaling Pathway (198871)

This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008]

NGF: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Homodimer. Belongs to the NGF-beta family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 1p13.1. Cellular Component: extracellular space; Golgi lumen; cytoplasmic membrane-bound vesicle; extracellular region; endosome. Molecular Function: metalloendopeptidase inhibitor activity; protein binding; nerve growth factor receptor binding; growth factor activity; receptor signaling protein activity. Biological Process: response to nicotine; circadian rhythm; response to peptide hormone stimulus; activation of MAPKK activity; nerve growth factor receptor signaling pathway; adult locomotory behavior; positive regulation of apoptosis; regulation of neuron differentiation; positive regulation of axon extension; response to glucocorticoid stimulus; regulation of neurotransmitter secretion; response to lipopolysaccharide; regulation of axonogenesis; regulation of caspase activity; sensory perception of pain; negative regulation of cell cycle; nerve growth factor processing; response to radiation; cell-cell signaling; small GTPase mediated signal transduction; negative regulation of neuron apoptosis; response to electrical stimulus; inflammatory response; response to drug; positive regulation of neuron maturation; phosphoinositide-mediated signaling; positive regulation of protein amino acid autophosphorylation; positive regulation of nerve growth factor receptor signaling pathway; regulation of release of sequestered calcium ion into cytosol; memory; peripheral nervous system development; neuron apoptosis; induction of apoptosis via death domain receptors; response to mechanical stimulus; phospholipase C activation; response to ozone; Ras protein signal transduction; positive regulation of transcription factor activity; positive regulation of axonogenesis; neurite morphogenesis; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis. Disease: Neuropathy, Hereditary Sensory And Autonomic, Type V

0.002 mg

140 USD

0.01 mg

205

0.1 mg

1030