product summary
request information :
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Endoglin
catalog :
MBS142300
quantity :
0.01 mg
price :
205 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS142300
products type :
Recombinant Protein
products full name :
Recombinant Mouse Endoglin
products short name :
Endoglin
products name syn :
Endoglin Mouse; Endoglin Mouse Recombinant; CD105; ENG; END; ORW; HHT1; ORW1; FLJ41744; Cell surface MJ7/18 antigen; Endoglin; mEndoglin
other names :
endoglin isoform 1; Endoglin; endoglin; cell surface MJ7/18 antigen; transmembrane glycoprotein; endoglin; Cell surface MJ7/18 antigen; CD_antigen: CD105
other gene names :
Eng; Eng; Endo; CD105; AI528660; AI662476; S-endoglin; Edg
uniprot entry name :
EGLN_MOUSE
host :
Insect Cells
sequence length :
653
sequence :
FTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVF LVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWA ATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTP VQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVS WFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFV ELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMT LALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVV SNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQV SVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSF LLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS.
MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPT
RGEVT
purity :
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
Endoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing no additives. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Endoglin although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CD105 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized CD-105 in sterile PBS not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
products categories :
CYTOKINES AND GROWTH FACTORS; Cytokines; Endoglin
products description :
Description: CD105 Mouse Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 581 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 75-85 kDa under reducing conditions in SDS-PAGE. Based on N-terminal sequence analysis, the primary structure of recombinant mature Endoglin starts at Glu 26. The CD105 is fused to a C-terminal His-tag (6xHis) and purified by proprietary chromatographic techniques. Introduction: Endoglin is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex.The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Endoglin has been found to be part of the TGF-beta1 receptor complex. It thus may be involved in the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, and BMP-7. Beside TGF-beta signaling endoglin may have other functions. It has been postulated that endoglin is involved in the cytoskeletal organization affecting cell morphology and migration. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling. Its expression is regulated during heart development. Experimental mice without the endoglin gene die due to cardiovascular abnormalities.
ncbi gi num :
226437647
ncbi acc num :
NP_031958.2
ncbi gb acc num :
NM_007932.2
uniprot acc num :
Q63961
ncbi mol weight :
70,021 Da
ncbi pathways :
TGF Beta Signaling Pathway 198393!!TGF-beta Receptor Signaling Pathway 198330!!XPodNet - Protein-protein Interactions In The Podocyte Expanded By STRING Pathway 755427
size :
0.01 mg
price :
205 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!