protein

Recombinant Human Neuregulin-1/Heregulin-b2

MBS142283

0.01 mg

140 USD

Recombinant Protein

Recombinant Human Neuregulin-1/Heregulin-b2

Neuregulin-1/Heregulin-b2

NRG1 Human; Heregulin-B2 Human Recombinant; Neuregulin-1; NRG1; GGF; HGL; HRGA; NDF; SMDF; HRG; ARIA; GGF2; HRG1

pro-neuregulin-1, membrane-bound isoform isoform HRG-beta1c; Pro-neuregulin-1, membrane-bound isoform; pro-neuregulin-1, membrane-bound isoform; glial growth factor; heregulin, alpha (45kD, ERBB2 p185-activator); neu differentiation factor; pro-NRG1; sensory and motor neuron derived factor; neuregulin 1; Acetylcholine receptor-inducing activity; ARIA; Breast cancer cell differentiation factor p45; Glial growth factor; Heregulin; HRG; Neu differentiation factor; Sensory and motor neuron-derived factor

NRG1

NRG1; NRG1; GGF; HGL; HRG; NDF; ARIA; GGF2; HRG1; HRGA; SMDF; MST131; MSTP131; NRG1-IT2; GGF; HGL; HRGA; NDF; SMDF; Pro-NRG1; ARIA; HRG

NRG1_HUMAN

E Coli

607

shlvkcaekektfcvnggecfmvkdlsnpsrylckcpne
ftgdrcqnyvmasfykaeelyq.

Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Lyophilized from a 0.2 um filtered solution in 20mM PB, pH 7.4, containing 150mM NaCl. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution Heregulin should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized NRG1 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2x104 Units/mg.

CYTOKINES AND GROWTH FACTORS; Neurotrophins; Neuregulin

Description: Recombinant Human Neuregulin-1 beta 2 produced in E Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7055 Dalton. NRG-1 is purified by proprietary chromatographic techniques. Introduction: Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that neuregulin recombinant could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that neuregulin (NRG1) recombinant can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.

236461509

NP_001153467.1

NM_001159995.1

Q02297

46,226 Da

Adaptive Immune System Pathway (366160); Cardiac Progenitor Differentiation Pathway (712094); Constitutive PI3K/AKT Signaling In Cancer Pathway (685535); DAP12 Interactions Pathway (685549); DAP12 Signaling Pathway (685550); Disease Pathway (530764); Downregulation Of ERBB2:ERBB3 Signaling Pathway (530740); Downstream Signal Transduction Pathway (106385); Downstream Signaling Events Of B Cell Receptor (BCR) Pathway (576250); Downstream Signaling Of Activated FGFR Pathway (160957)

The protein encoded by this gene is a membrane glycoprotein that that mediates cell-cell signaling and plays a critical role in the growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are expressed in a tissue-specific manner and differ significantly in their structure, and are classified as types I, II, III, IV, V and VI. Dysregulation of this gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Jun 2014]

NRG1: Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. The cytoplasmic domain interacts with the LIM domain region of LIMK1. Interacts with ERBB3 and ERBB4. Type I isoforms are the predominant forms expressed in the endocardium. Isoform alpha is expressed in breast, ovary, testis, prostate, heart, skeletal muscle, lung, placenta liver, kidney, salivary gland, small intestine and brain, but not in uterus, stomach, pancreas, and spleen. Isoform 3 is the predominant form in mesenchymal cells and in non-neuronal organs, whereas isoform 6 is the major neuronal form. Isoform 8 is expressed in spinal cord and brain. Isoform 9 is the major form in skeletal muscle cells; in the nervous system it is expressed in spinal cord and brain. Also detected in adult heart, placenta, lung, liver, kidney, and pancreas. Isoform 10 is expressed in nervous system: spinal cord motor neurons, dorsal root ganglion neurons, and brain. Predominant isoform expressed in sensory and motor neurons. Not detected in adult heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Not expressed in fetal lung, liver and kidney. Type IV isoforms are brain-specific. Belongs to the neuregulin family. 10 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Cytokine; Motility/polarity/chemotaxis; Cell development/differentiation; Ligand, receptor tyrosine kinase. Chromosomal Location of Human Ortholog: 8p12. Cellular Component: extracellular space; membrane; axon; integral to plasma membrane; cytoplasm; apical plasma membrane; extracellular region; nucleus; neuromuscular junction. Molecular Function: ErbB-2 class receptor binding; protein binding; transmembrane receptor protein tyrosine kinase activator activity; ErbB-3 class receptor binding; growth factor activity; transcription cofactor activity; cytokine activity; protein tyrosine kinase activator activity; receptor tyrosine kinase binding; receptor binding. Biological Process: regulation of protein heterodimerization activity; transmembrane receptor protein tyrosine kinase activation (dimerization); positive regulation of cell adhesion; cellular protein complex disassembly; neural crest cell development; nerve growth factor receptor signaling pathway; wound healing; ventricular cardiac muscle cell differentiation; cell morphogenesis; locomotory behavior; positive regulation of striated muscle cell differentiation; cardiac muscle cell differentiation; synaptogenesis; mammary gland development; cell communication; positive regulation of cardiac muscle cell proliferation; epidermal growth factor receptor signaling pathway; nervous system development; cell migration; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; neurotransmitter receptor metabolic process; regulation of protein homodimerization activity; MAPKKK cascade; neuron fate commitment; positive regulation of cell growth; peripheral nervous system development; positive regulation of protein kinase B signaling cascade; cell proliferation; embryonic development; glial cell fate commitment; innate immune response; negative regulation of secretion; positive regulation of Ras protein signal transduction; negative regulation of protein catabolic process; negative regulation of transcription, DNA-dependent; transmembrane receptor protein tyrosine kinase signaling pathway. Disease: Schizophrenia 6

0.01 mg

140 USD

0.05 mg

205

1 mg

1365