product summary
request information :
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Interleukin-1 beta
catalog :
MBS142270
quantity :
0.01 mg
price :
205 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS142270
products type :
Recombinant Protein
products full name :
Recombinant Rat Interleukin-1 beta
products short name :
Interleukin-1 beta
products name syn :
IL 1 beta Rat; Interleukin-1 beta Rat Recombinant; Catabolin; Lymphocyte-activating factor (LAF); Endogenous Pyrogen (EP); Leukocyte Endogenous Mediator (LEM); Mononuclear Cell Factor (MCF); IL1F2; IL-1 beta
other names :
Interleukin-1 beta; Interleukin-1 beta; interleukin-1 beta; IL-1 beta; interleukin 1 beta; N/A
products gene name :
rIL 1 beta
other gene names :
Il1b; Il1b; IL-1 beta
uniprot entry name :
IL1B_RAT
host :
E Coli
sequence length :
268
sequence :
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQ
QVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGT
PTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQ
FPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
purity :
Greater than 97.0% as determined by SDS-PAGE.
form :
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution IL1b should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Protein Content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard. Biological Activity: The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.
products categories :
CYTOKINES AND GROWTH FACTORS; Cytokines; Interleukin
products description :
Introduction: Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
ncbi gi num :
2497335
ncbi acc num :
Q63264.1
uniprot acc num :
Q63264
ncbi mol weight :
30,644 Da
ncbi pathways :
African Trypanosomiasis Pathway 194377!!African Trypanosomiasis Pathway 194323!!Alzheimer's Disease Pathway 83489!!Alzheimer's Disease Pathway 509!!Amoebiasis Pathway 167311!!Amoebiasis Pathway 167191!!Apoptosis Pathway 83452!!Apoptosis Pathway 470!!Chagas Disease (American Trypanosomiasis) Pathway 147806!!Chagas Disease (American Trypanosomiasis) Pathway 147795
ncbi summary :
an inflammatory cytokine [RGD, Feb 2006]
size :
0.01 mg
price :
205 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!