catalog number :
MBS142266
products type :
Recombinant Protein
products full name :
Recombinant Human Endoglin, Sf9
products short name :
Endoglin
products name syn :
Endoglin Human, Sf9; Endoglin Human Recombinant, Sf9; CD105; ENG; END; ORW; HHT1; ORW1; FLJ41744; Endoglin; Endoglin Sf9
other names :
endoglin isoform 2; Endoglin; endoglin; CD105 antigen; endoglin; CD_antigen: CD105
other gene names :
ENG; ENG; END; HHT1; ORW1; END
uniprot entry name :
EGLN_HUMAN
sequence :
TTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVL SVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPI TSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLID ANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPL ASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKE LVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNI LSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSE FLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPI PKTGTLSCTVALRPKTGS.
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPER
GEVTY
purity :
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
Endoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Endoglin although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CD105 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized CD-105 in sterile PBS not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
products categories :
CYTOKINES AND GROWTH FACTORS; Cytokines; Endoglin
products description :
Description: CD105 Human Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 586 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 90 kDa under reducing conditions in SDS-PAGE. The CD105 is fused to a C-terminal His-tag (6xHis) and purified by proprietary chromatographic techniques. Introduction: Endoglin is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex.The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Endoglin has been found to be part of the TGF-beta1 receptor complex. It thus may be involved in the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, and BMP-7. Beside TGF-beta signaling endoglin may have other functions. It has been postulated that endoglin is involved in the cytoskeletal organization affecting cell morphology and migration. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling. Its expression is regulated during heart development. Experimental mice without the endoglin gene die due to cardiovascular abnormalities.
ncbi acc num :
NP_000109.1
ncbi gb acc num :
NM_000118.3
ncbi mol weight :
67,542 Da
ncbi pathways :
HIF-1-alpha Transcription Factor Network Pathway (138045); TGF Beta Signaling Pathway (198810); TGF-beta Receptor Signaling Pathway (198774)
ncbi summary :
This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013]
uniprot summary :
ENG: Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Homodimer that forms an heteromeric complex with the signaling receptors for transforming growth factor-beta: TGFBR1 and/or TGFBR2. It is able to bind TGF-beta 1, and 3 efficiently and TGF-beta 2 less efficiently. Interacts with TCTEX1D4. Interacts with ARRB2. Endoglin is restricted to endothelial cells in all tissues except bone marrow. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: 9q34.11. Cellular Component: nucleoplasm; extracellular space; cell surface; focal adhesion; cytoplasm; receptor complex; external side of plasma membrane. Molecular Function: transforming growth factor beta receptor activity; protein binding; transmembrane receptor activity; protein homodimerization activity; glycosaminoglycan binding; transforming growth factor beta binding; galactose binding; punt binding; activin binding; transforming growth factor beta receptor, cytoplasmic mediator activity. Biological Process: wound healing; positive regulation of collagen biosynthetic process; cell motility involved in cell locomotion; positive regulation of systemic arterial blood pressure; negative regulation of transcription from RNA polymerase II promoter; response to corticosteroid stimulus; BMP signaling pathway; smooth muscle development; extracellular matrix disassembly; venous blood vessel morphogenesis; central nervous system vasculogenesis; regulation of transforming growth factor beta receptor signaling pathway; regulation of transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; negative regulation of protein amino acid autophosphorylation; heart looping; chronological cell aging; vasculogenesis; cell adhesion; negative regulation of cell migration; positive regulation of BMP signaling pathway; regulation of cell adhesion; cell migration; negative regulation of nitric-oxide synthase activity; regulation of phosphorylation; regulation of cell proliferation; patterning of blood vessels; negative regulation of endothelial cell proliferation; response to hypoxia; artery morphogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway. Disease: Telangiectasia, Hereditary Hemorrhagic, Of Rendu, Osler, And Weber