Human B-type Natriuretic Protein | MyBioSource MBS142246 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Human B-type Natriuretic Protein

catalog :

MBS142246

quantity :

10 mg

price :

360 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS142246

products type :

Native Protein

products full name :

Human B-type Natriuretic Protein

products short name :

B-type Natriuretic

products name syn :

BNP Human; B-type Natriuretic Peptide Human; NPPB; Natriuretic Peptide Precursor B; BNP; B-type Natriuretic Peptide

other names :

natriuretic peptides B preproprotein; Natriuretic peptides B; natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein; natriuretic peptide B; Gamma-brain natriuretic peptideCleaved into the following 16 chains:Brain natriuretic peptide 32; BNP(1-32); BNP-32; BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32); BNP(3-30); BNP(3-29); BNP(4-32); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)

products gene name :

BNP

other gene names :

NPPB; NPPB; BNP; BNP(1-32); BNP-32

uniprot entry name :

ANFB_HUMAN

sequence length :

134

sequence :

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

purity :

Greater than 95.0% as determined by RP-HPLC.

form :

The protein was lyophilized without additives. Sterile Filtered White lyophilized (freeze-dried) powder.

storage stability :

Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

other info2 :

Solubility: It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

products categories :

CYTOKINES AND GROWTH FACTORS; Cytokines; B type Natriuretic Peptide

products description :

Description: B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4. Introduction: Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.

ncbi gi num :

4505433

ncbi acc num :

NP_002512.1

ncbi gb acc num :

NM_002521.2

uniprot acc num :

P16860

ncbi mol weight :

14,726 Da

ncbi pathways :

MicroRNAs In Cardiomyocyte Hypertrophy Pathway (198784); CGMP-PKG Signaling Pathway (983748); CGMP-PKG Signaling Pathway (985584)

ncbi summary :

This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq, Nov 2014]

uniprot summary :

NPPB: Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Belongs to the natriuretic peptide family. Protein type: Secreted; Hormone; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 1p36.2. Cellular Component: extracellular space; protein complex; extracellular region. Molecular Function: diuretic hormone activity; hormone activity; receptor binding. Biological Process: cGMP biosynthetic process; negative regulation of angiogenesis; cell surface receptor linked signal transduction; regulation of vasodilation; receptor guanylyl cyclase signaling pathway; regulation of blood pressure; regulation of vascular permeability; negative regulation of cell growth; body fluid secretion; regulation of blood vessel size

size1 :

10 mg

price1 :

360 USD

size2 :

25 mg

price2 :

550

size3 :

100 mg

price3 :

1500

more info or order :

MyBioSource product webpage