catalog number :
MBS142187
products type :
Recombinant Protein
products full name :
Recombinant Human Melanoma Inhibitory Activity Protein
products short name :
Melanoma Inhibitory Activity
products name syn :
MIA Human; Melanoma Inhibitory Activity Human Recombinant; Melanoma-derived growth regulatory protein precursor; Cartilage-derived retinoic acid-sensitive protein; CD-RAP; MIA
other names :
melanoma-derived growth regulatory protein; Melanoma-derived growth regulatory protein; melanoma-derived growth regulatory protein; melanoma inhibitory activity; Melanoma inhibitory activity protein
other gene names :
MIA; MIA; CD-RAP
uniprot entry name :
MIA_HUMAN
sequence :
residue.MGPMPKLADRKLCADQECSSHPISMAVALQD
YMAPDCRFLTIHRGQVVYVFSLKGRGRFLWGGSVQGDYY
GDLAARLGYFPSSIVREDQTLKVDVKTDKWDFYCQ.
Agrees with the sequence of native MIA human with an addition N-terminal Methionine
purity :
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
form :
The protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MIA should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.
other info2 :
Solubility: It is recommended to reconstitute the lyophilized Melanoma Inhibitory Activity in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Protein Content: UV spectroscopy at 280 nm using the absorption coefficient of 19300 M-1cm-1. Biological Activity: The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells and found active in Mel In assay.
products categories :
CYTOKINES AND GROWTH FACTORS; Growth Factors; Melanoma Inhibitory Activity
products description :
Description: Melanoma Inhibitory Activity Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton.The MIA is purified by proprietary chromatographic techniques. Introduction: The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain. MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors, including gliomas, in an autocrine fashion. In a study of human melanoma cell lines with different metastatic capacity MIA mRNA expression appeared to be inversely correlated with pigmentation. MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful for staging of primary melanomas, detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas.
ncbi acc num :
NP_001189482.1
ncbi gb acc num :
NM_001202553.1
ncbi mol weight :
6,361 Da
ncbi pathways :
Neural Crest Differentiation Pathway (672460)
uniprot summary :
MIA: Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas. Belongs to the MIA/OTOR family. Protein type: Cell adhesion; Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 19q13.2. Cellular Component: extracellular space. Molecular Function: growth factor activity. Biological Process: cell proliferation