catalog number :
MBS1421752
products type :
Recombinant Protein
products full name :
Recombinant Human Hydroxyacid oxidase 2 (HAO2)
products short name :
[Hydroxyacid oxidase 2 (HAO2)]
products name syn :
[Hydroxyacid oxidase 2; HAOX2; EC=1.1.3.15; (S)-2-hydroxy-acid oxidase, peroxisomal; Cell growth-inhibiting gene 16 protein; Long chain alpha-hydroxy acid oxidase; Long-chain L-2-hydroxy acid oxidase]
other names :
[hydroxyacid oxidase 2; Hydroxyacid oxidase 2; hydroxyacid oxidase 2; glycolate oxidase; long-chain L-2-hydroxy acid oxidase; long chain alpha-hydroxy acid oxidase; cell growth-inhibiting gene 16 protein; (S)-2-hydroxy-acid oxidase, peroxisomal; hydroxyacid oxidase 2 (long chain); (S)-2-hydroxy-acid oxidase, peroxisomal; Cell growth-inhibiting gene 16 protein; Long chain alpha-hydroxy acid oxidase; Long-chain L-2-hydroxy acid oxidase]
products gene name :
[HAO2]
products gene name syn :
[HAO2; HAOX2; GIG16]
other gene names :
[HAO2; HAO2; GIG16; HAOX2; HAOX2; HAOX2]
uniprot entry name :
HAOX2_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[2-351aa; Full Length of Mature Protein]
sequence :
SLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIA
AFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTG
FHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVI
AAPEGLRWFQLYVHPDLQLNKQLIQRVESLGFKALVITL
DTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQM
TPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVK
HNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEV
YLDGGVRTGNDVLKALALGAKCIFLGRPILWGLACKGEH
GVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSRL
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Homo sapiens (Human)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Tags & Cell Markers
products description :
Catalyzes the oxidation of L-alpha-hydroxy acids as well as, more slowly, that of L-alpha-amino acids.
ncbi acc num :
NP_001005783.1
ncbi gb acc num :
NM_001005783.1
ncbi mol weight :
40,391 Da
ncbi pathways :
Glyoxylate And Dicarboxylate Metabolism Pathway (83002); Glyoxylate And Dicarboxylate Metabolism Pathway (383); Metabolic Pathways (132956); Peroxisome Pathway (131226); Peroxisome Pathway (131126)
ncbi summary :
This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
uniprot summary :
HAO2: Catalyzes the oxidation of L-alpha-hydroxy acids as well as, more slowly, that of L-alpha-amino acids. Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenase family. Protein type: Carbohydrate Metabolism - glyoxylate and dicarboxylate; EC 1.1.3.15; Oxidoreductase. Chromosomal Location of Human Ortholog: 1p12. Cellular Component: mitochondrion; peroxisome. Molecular Function: FMN binding; receptor binding; (S)-2-hydroxy-acid oxidase activity. Biological Process: mandelate metabolic process; fatty acid oxidation; protein homooligomerization