product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Adiponectin
catalog :
MBS142157
quantity :
0.005 mg
price :
140 USD
more info or order :
product information
catalog number :
MBS142157
products type :
Recombinant Protein
products full name :
Recombinant Human Adiponectin
products short name :
Adiponectin
products name syn :
Acrp30 Human; Adiponectin Human Recombinant; Acrp30; AdipoQ; GBP-28; APM-1; ACDC
other names :
adiponectin; Adiponectin; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; gelatin-binding protein 28; adiponectin, C1Q and collagen domain containing; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1; Gelatin-binding protein
products gene name :
Acrp30
other gene names :
ADIPOQ; ADIPOQ; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1; ACDC; ACRP30; APM1; GBP28; ACRP30; apM-1
uniprot entry name :
ADIPO_HUMAN
host :
E Coli
sequence length :
244
sequence :
MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGA
PGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGP
RGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPI
RFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMK
DVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVG
DQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
purity :
Acrp30 purity is greater than 90% as determined by SDS-PAGE.
form :
Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1mM DTT. Sterile Filtered clear solution.
storage stability :
Store Acrp30 at -20 degree C. Can be stored at 4 degree C for a limited period of time of 7 days.
other info2 :
Patent Rights: The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A).
products categories :
CYTOKINES AND GROWTH FACTORS; Cytokines; Adiponectin
products description :
Description: The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E Coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244). Introduction: The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.
ncbi gi num :
295317372
ncbi acc num :
NP_001171271.1
ncbi gb acc num :
NM_001177800.1
uniprot acc num :
Q15848
ncbi mol weight :
26,414 Da
ncbi pathways :
AMPK Signaling Pathway (198868); AMPK Signaling Pathway (989139); AMPK Signaling Pathway (992181); Adipocytokine Signaling Pathway (83093); Adipocytokine Signaling Pathway (505); Adipogenesis Pathway (198832); Developmental Biology Pathway (477129); Non-alcoholic Fatty Liver Disease (NAFLD) Pathway (862188); Non-alcoholic Fatty Liver Disease (NAFLD) Pathway (862314); PPAR Signaling Pathway (83042)
ncbi summary :
This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]
uniprot summary :
adiponectin: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. Homomultimer. Forms trimers, hexamers and 12- to 18-mers. The trimers (low molecular weight complexes / LMW) are assembled via non-covalent interactions of the collagen-like domains in a triple helix and hydrophobic interactions within the globular C1q domain. Several trimers can associate to form disulfide-linked hexamers (middle molecular weight complexes / MMW) and larger complexes (higher molecular weight / HMW). The HMW-complex assembly may rely aditionally on lysine hydroxylation and glycosylation. LMW, MMW and HMW complexes bind to HBEGF, MMW and HMW complexes bind to PDGFB, and HMW complex binds to FGF2. Interacts with CTRP9A via the C1q domain (heterotrimeric complex). Synthesized exclusively by adipocytes and secreted into plasma. Protein type: Secreted, signal peptide; Secreted; Endoplasmic reticulum; Hormone. Chromosomal Location of Human Ortholog: 3q27. Cellular Component: extracellular space; collagen; cell surface; endoplasmic reticulum; extracellular region. Molecular Function: identical protein binding; protein binding; protein homodimerization activity; hormone activity; cytokine activity; sialic acid binding; receptor binding. Biological Process: circadian rhythm; negative regulation of phagocytosis; negative regulation of MAP kinase activity; negative regulation of smooth muscle cell proliferation; negative regulation of hormone secretion; membrane hyperpolarization; response to glucocorticoid stimulus; positive regulation of cellular protein metabolic process; negative regulation of smooth muscle cell migration; glucose homeostasis; negative regulation of granulocyte differentiation; positive regulation of interleukin-8 production; positive regulation of glucose import; negative regulation of gluconeogenesis; response to glucose stimulus; adiponectin-mediated signaling pathway; negative regulation of protein amino acid autophosphorylation; negative regulation of blood pressure; negative regulation of cell migration; response to nutrient; protein homooligomerization; generation of precursor metabolites and energy; positive regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of heterotypic cell-cell adhesion; positive regulation of signal transduction; glucose metabolic process; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of tumor necrosis factor production; negative regulation of fat cell differentiation; negative regulation of synaptic transmission; response to sucrose stimulus; membrane depolarization; positive regulation of peptidyl-tyrosine phosphorylation; fatty acid beta-oxidation; positive regulation of fatty acid metabolic process; response to ethanol; cellular response to insulin stimulus; negative regulation of low-density lipoprotein receptor biosynthetic process; negative regulation of macrophage differentiation; negative regulation of inflammatory response; brown fat cell differentiation; response to hypoxia; fatty acid oxidation; positive regulation of protein amino acid phosphorylation; response to activity; negative regulation of transcription, DNA-dependent; positive regulation of myeloid cell apoptosis; positive regulation of blood pressure. Disease: Adiponectin, Serum Level Of, Quantitative Trait Locus 1
size1 :
0.005 mg
price1 :
140 USD
size2 :
0.025 mg
price2 :
205
size3 :
1 mg
price3 :
2750
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!