protein

Recombinant Human Adiponectin

MBS142157

0.005 mg

140 USD

Recombinant Protein

Recombinant Human Adiponectin

Adiponectin

Acrp30 Human; Adiponectin Human Recombinant; Acrp30; AdipoQ; GBP-28; APM-1; ACDC

adiponectin; Adiponectin; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; gelatin-binding protein 28; adiponectin, C1Q and collagen domain containing; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1; Gelatin-binding protein

Acrp30

ADIPOQ; ADIPOQ; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1; ACDC; ACRP30; APM1; GBP28; ACRP30; apM-1

ADIPO_HUMAN

E Coli

244

MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGA
PGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGP
RGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPI
RFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMK
DVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVG
DQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.

Acrp30 purity is greater than 90% as determined by SDS-PAGE.

Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1mM DTT. Sterile Filtered clear solution.

Store Acrp30 at -20 degree C. Can be stored at 4 degree C for a limited period of time of 7 days.

Patent Rights: The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A).

CYTOKINES AND GROWTH FACTORS; Cytokines; Adiponectin

Description: The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E Coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244). Introduction: The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.

295317372

NP_001171271.1

NM_001177800.1

Q15848

26,414 Da

AMPK Signaling Pathway (198868); AMPK Signaling Pathway (989139); AMPK Signaling Pathway (992181); Adipocytokine Signaling Pathway (83093); Adipocytokine Signaling Pathway (505); Adipogenesis Pathway (198832); Developmental Biology Pathway (477129); Non-alcoholic Fatty Liver Disease (NAFLD) Pathway (862188); Non-alcoholic Fatty Liver Disease (NAFLD) Pathway (862314); PPAR Signaling Pathway (83042)

This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]

adiponectin: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. Homomultimer. Forms trimers, hexamers and 12- to 18-mers. The trimers (low molecular weight complexes / LMW) are assembled via non-covalent interactions of the collagen-like domains in a triple helix and hydrophobic interactions within the globular C1q domain. Several trimers can associate to form disulfide-linked hexamers (middle molecular weight complexes / MMW) and larger complexes (higher molecular weight / HMW). The HMW-complex assembly may rely aditionally on lysine hydroxylation and glycosylation. LMW, MMW and HMW complexes bind to HBEGF, MMW and HMW complexes bind to PDGFB, and HMW complex binds to FGF2. Interacts with CTRP9A via the C1q domain (heterotrimeric complex). Synthesized exclusively by adipocytes and secreted into plasma. Protein type: Secreted, signal peptide; Secreted; Endoplasmic reticulum; Hormone. Chromosomal Location of Human Ortholog: 3q27. Cellular Component: extracellular space; collagen; cell surface; endoplasmic reticulum; extracellular region. Molecular Function: identical protein binding; protein binding; protein homodimerization activity; hormone activity; cytokine activity; sialic acid binding; receptor binding. Biological Process: circadian rhythm; negative regulation of phagocytosis; negative regulation of MAP kinase activity; negative regulation of smooth muscle cell proliferation; negative regulation of hormone secretion; membrane hyperpolarization; response to glucocorticoid stimulus; positive regulation of cellular protein metabolic process; negative regulation of smooth muscle cell migration; glucose homeostasis; negative regulation of granulocyte differentiation; positive regulation of interleukin-8 production; positive regulation of glucose import; negative regulation of gluconeogenesis; response to glucose stimulus; adiponectin-mediated signaling pathway; negative regulation of protein amino acid autophosphorylation; negative regulation of blood pressure; negative regulation of cell migration; response to nutrient; protein homooligomerization; generation of precursor metabolites and energy; positive regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of heterotypic cell-cell adhesion; positive regulation of signal transduction; glucose metabolic process; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of tumor necrosis factor production; negative regulation of fat cell differentiation; negative regulation of synaptic transmission; response to sucrose stimulus; membrane depolarization; positive regulation of peptidyl-tyrosine phosphorylation; fatty acid beta-oxidation; positive regulation of fatty acid metabolic process; response to ethanol; cellular response to insulin stimulus; negative regulation of low-density lipoprotein receptor biosynthetic process; negative regulation of macrophage differentiation; negative regulation of inflammatory response; brown fat cell differentiation; response to hypoxia; fatty acid oxidation; positive regulation of protein amino acid phosphorylation; response to activity; negative regulation of transcription, DNA-dependent; positive regulation of myeloid cell apoptosis; positive regulation of blood pressure. Disease: Adiponectin, Serum Level Of, Quantitative Trait Locus 1

0.005 mg

140 USD

0.025 mg

205

1 mg

2750