catalog number :
MBS142121
products type :
Recombinant Protein
products full name :
Recombinant Human Hepatocyte Growth Factor, Sf9
products short name :
Hepatocyte Growth Factor
products name syn :
HGF Human; Hepatocyte Growth Factor Human Recombinant; Scatter Factor (SF); Hepatopoietin (HPTA); HGF; HGFB; F-TCF; HGF Sf9
other names :
hepatocyte growth factor isoform 1 preproprotein; Hepatocyte growth factor; hepatocyte growth factor; fibroblast-derived tumor cytotoxic factor; hepatopoeitin-A; hepatopoietin-A; lung fibroblast-derived mitogen; hepatocyte growth factor (hepapoietin A; scatter factor); Hepatopoietin-A; Scatter factor; SF
other gene names :
HGF; HGF; SF; HGFB; HPTA; F-TCF; DFNB39; HPTA; SF
uniprot entry name :
HGF_HUMAN
sequence :
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQC
ANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVK
KEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIK
CQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTS
NPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKI
CQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPW
CYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQ
GEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKD
LRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSH
GQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHI
FWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCP
ISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTN
IGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKD
YEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLM
KLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTG
LINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAI
PNRPGIFVRVAYYAKWIHKIILTYKVPQS.
purity :
Greater than 95.0% as determined by SDS-PAGE.
form :
The sterile protein powder (1 mg/ml) is lyophilized from a solution containing 50mM acetic acid. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution HGF should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Biological Activity: The activity was assayed for scattering activity in the MDCK cell assay. The ED50 for this effect is typically at 1.0-5.0 ng/ml (200,000-1,000,000 IU/mg).
products categories :
CYTOKINES AND GROWTH FACTORS; Growth Factors; Hepatocyte Growth Factor
products description :
Description: Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.The HGF is purified by proprietary chromatographic techniques. Introduction: Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis.
ncbi acc num :
NP_000592.3
ncbi gb acc num :
NM_000601.4
ncbi mol weight :
24,116 Da
ncbi pathways :
Arf6 Signaling Events Pathway (138034); Cytokine Signaling In Immune System Pathway (366171); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Direct P53 Effectors Pathway (137939); FGF Signaling Pathway (137989); Focal Adhesion Pathway (198795); Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); Hemostasis Pathway (106028)
ncbi summary :
Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
uniprot summary :
HGF: HGF is a potent mitogen for mature parenchymal hepatocyte cells, seems to be an hepatotrophic factor, and acts as growth factor for a broad spectrum of tissues and cell types. It has no detectable protease activity. Activating ligand for the receptor tyrosine kinase MET by binding and promoting its dimerization. Defects in HGF are the cause of deafness autosomal recessive type 39 (DFNB39). A form of profound prelingual sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the peptidase S1 family. Plasminogen subfamily. 6 isoforms of the human protein are produced by alternative splicing. Protein type: Motility/polarity/chemotaxis; Hormone; Cell development/differentiation. Chromosomal Location of Human Ortholog: 7q21.1. Cellular Component: extracellular space; membrane; extracellular region. Molecular Function: identical protein binding; protein binding; growth factor activity; protein heterodimerization activity; serine-type endopeptidase activity; chemoattractant activity. Biological Process: positive regulation of myelination; mitosis; platelet activation; organ regeneration; activation of MAPK activity; myoblast proliferation; hepatocyte growth factor receptor signaling pathway; negative regulation of caspase activity; liver development; proteolysis; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of osteoblast differentiation; positive regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; platelet degranulation; positive chemotaxis; epithelial to mesenchymal transition; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; hyaluronan metabolic process; positive regulation of cell migration. Disease: Deafness, Autosomal Recessive 39