product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Vascular Endothelial Growth Factor (121), Sf9
catalog :
MBS142077
quantity :
0.01 mg
price :
205 USD
more info or order :
product information
catalog number :
MBS142077
products type :
Recombinant Protein
products full name :
Recombinant Human Vascular Endothelial Growth Factor (121), Sf9
products short name :
Vascular Endothelial Growth Factor
products name syn :
VEGF (121 a.a.) Human, Sf9; Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9; Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF; VEGF; MGC70609; VEGF (121a.a.) Sf9
other names :
vascular endothelial growth factor A isoform a; Vascular endothelial growth factor A; vascular endothelial growth factor A; vascular permeability factor; vascular endothelial growth factor A; Vascular permeability factor; VPF
products gene name :
VEGF
other gene names :
VEGFA; VEGFA; VPF; VEGF; MVCD1; VEGF; VEGF-A; VPF
uniprot entry name :
VEGFA_HUMAN
host :
Sf9 Insect Cells
sequence length :
412
sequence :
CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEY
PDEIEYIFKPS
purity :
Greater than 95.0% as determined by SDS-PAGE.
form :
The protein was lyophilized from a solution containing 50mM acetic acid. Sterile Filtered White lyophilized (freeze-dried) powder.
storage stability :
Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution VEGF-121 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
other info2 :
Solubility: The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50 ug/ml. Biological Activity: The ED50 for stimulation of 3H-thymidine incorporation and cell proliferation by human umbilical vein endothelial cells for VEGF121 has been determined to be in the range of 1-4 ng/ml.
products categories :
CYTOKINES AND GROWTH FACTORS; Growth Factors; VEGF
products description :
Description: Vascular Endothelial Growth Factor-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa.VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates.The VEGF-121 is purified by proprietary chromatographic techniques. Introduction: Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g. stimulation monocyte/ macrophagemigration, neurons, cancer cells, kidney epithelial cells).VEGF mediates increased vascular permeability, induces angiogenesis, vasculogenesis and endothelial cell growth, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesisand cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor.Elevated levels of this protein are linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy.
ncbi gi num :
76781480
ncbi acc num :
NP_001020537.2
ncbi gb acc num :
NM_001025366.2
uniprot acc num :
P15692
ncbi mol weight :
34,406 Da
ncbi pathways :
Angiogenesis Pathway 198772!!Axon Guidance Pathway 105688!!Bladder Cancer Pathway 83115!!Bladder Cancer Pathway 527!!Cellular Response To Hypoxia Pathway 645259!!Cellular Responses To Stress Pathway 645258!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Developmental Biology Pathway 477129!!EPH-Ephrin Signaling Pathway 1127691
ncbi summary :
This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. [provided by RefSeq, Jul 2008]
size :
0.01 mg
price :
205 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!