product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Collagen alpha-1(XII) chain
catalog :
MBS1420623
quantity :
0.01 mg (E-Coli)
price :
160 USD
more info or order :
image
image 1 :
product information
catalog number :
MBS1420623
products type :
Recombinant Protein
products full name :
Recombinant Human Collagen alpha-1(XII) chain
products short name :
[Collagen alpha-1(XII) chain]
products name syn :
[Homo sapiens (Human)]
other names :
[collagen alpha-1(XII) chain long isoform; Collagen alpha-1(XII) chain; collagen alpha-1(XII) chain; collagen type XII alpha 1]
products gene name :
[COL12A1]
other gene names :
[COL12A1; COL12A1; COL12A1L; BA209D8.1; DJ234P15.1; COL12A1L]
uniprot entry name :
COCA1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[140-316aa; Partial]
sequence length :
3063
sequence :
DLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTR
VGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNT
MTGDAIDYLVKNTFTESAGARVGFPKVAIIITDGKSQDE
VEIPARELRNVGVEVFSLGIKAADAKELKQIASTPSLNH
VFNVANFDAIVDIQNEIISQV
VGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNT
MTGDAIDYLVKNTFTESAGARVGFPKVAIIITDGKSQDE
VEIPARELRNVGVEVFSLGIKAADAKELKQIASTPSLNH
VFNVANFDAIVDIQNEIISQV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Species: Homo sapiens (Human)
products categories :
Signal Transduction
products description :
Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix.
products references :
Complete primary structure of two splice variants of collagen XII, and assignment of alpha 1(XII) collagen (COL12A1), alpha 1(IX) collagen (COL9A1), and alpha 1(XIX) collagen (COL19A1) to human chromosome 6q12-q13."
Gerecke D.R., Olson P.F., Koch M., Knoll J.H.M., Taylor R., Hudson D.L., Champliaud M.-F., Olsen B.R., Burgeson R.E.
Genomics 41:236-242(1997)
ncbi gi num :
93141047
ncbi acc num :
NP_004361.3
ncbi gb acc num :
NM_004370.5
uniprot acc num :
Q99715
ncbi mol weight :
23.61kD
ncbi pathways :
Collagen Biosynthesis And Modifying Enzymes Pathway (1270246); Collagen Degradation Pathway (1270259); Collagen Formation Pathway (1270245); Degradation Of The Extracellular Matrix Pathway (1270257); Extracellular Matrix Organization Pathway (1270244); Protein Digestion And Absorption Pathway (172847); Protein Digestion And Absorption Pathway (171868)
ncbi summary :
This gene encodes the alpha chain of type XII collagen, a member of the FACIT (fibril-associated collagens with interrupted triple helices) collagen family. Type XII collagen is a homotrimer found in association with type I collagen, an association that is thought to modify the interactions between collagen I fibrils and the surrounding matrix. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
uniprot summary :
COL12A1: Type XII collagen interacts with type I collagen- containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix. Belongs to the fibril-associated collagens with interrupted helices (FACIT) family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted; Extracellular matrix; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 6q12-q13. Cellular Component: collagen type XII; endoplasmic reticulum lumen; extracellular matrix; extracellular region; extracellular space. Molecular Function: extracellular matrix structural constituent conferring tensile strength. Biological Process: cell adhesion; collagen catabolic process; collagen fibril organization; extracellular matrix disassembly; extracellular matrix organization and biogenesis; skeletal development. Disease: Bethlem Myopathy 2; Ullrich Congenital Muscular Dystrophy 2
size1 :
0.01 mg (E-Coli)
price1 :
160 USD
size2 :
0.05 mg (E-Coli)
price2 :
200
size3 :
0.1 mg (E-Coli)
price3 :
295
size4 :
0.2 mg (E-Coli)
price4 :
480
size5 :
0.5 mg (E-Coli)
price5 :
790
size6 :
1 mg (E-Coli)
price6 :
1215
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
browse more products
questions and comments