MyBioSource

protein

Recombinant Human I-TAC (CXCL11)

MBS142041

0.02 mg

205 USD

MBS142041

Recombinant Protein

Recombinant Human I-TAC (CXCL11)

I-TAC

I TAC Human; I-TAC Human Recombinant (CXCL11); Small inducible cytokine B11; CXCL11; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Interferon-gamma-inducible protein 9; IP-9; H174; Beta-R1; chemokine (C-X-C motif) ligand 11; IP9; b-R1; SCYB11; SCYB9B; MGC102770

C-X-C motif chemokine 11 isoform 2; C-X-C motif chemokine 11; C-X-C motif chemokine 11; beta-R1; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine B11; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; small-inducible cytokine B11; chemokine (C-X-C motif) ligand 11; Beta-R1; H174; Interferon gamma-inducible protein 9; IP-9; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11

I TAC

CXCL11; CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; ITAC; SCYB11; SCYB9B; IP-9; I-TAC

CXL11_HUMAN

E Coli

106

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF.

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution I-TAC should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized I-TAC in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml.

CHEMOKINES; Chemokines; I-TAC (CXCL11)

Description: I-TAC Human Recombinant (Interferon-inducible T-cell alpha chemoattractant) produced in E Coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 8300 Dalton. The I-TAC is purified by proprietary chromatographic techniques. Introduction: Chemokine (C-X-C motif) ligand 11 (CXCL11) is a small cytokine belonging to the CXC chemokinen family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9). I-TAC is highly expressed in peripheral blood leukocytes, pancreas and liver, with moderate levels in thymus, spleen and lung and low expression levels were in small intestine, placenta and prostate. Gene expression of CXCL11 is strongly induced by IFN-g and IFN-b, and weakly induced by IFN-a. The I-TAC chemokine elicits its effects on its target cells by interacting with the cell surface chemokine receptor CXCR3, with a higher affinity than do the other ligands for this receptor, CXCL9 and CXCL10. I-TAC is chemotactic for activated T cells. The CXCL11 gene is located on human chromosome 4 along with many other members of the CXC chemokine family.

693074655

NP_001289052.1

NM_001302123.1

O14625

10,365 Da

CXCR3-mediated Signaling Events Pathway 138011!!Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway 1127664!!Disease Pathway 530764!!G Alpha (i) Signalling Events Pathway 119550

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]

0.02 mg

205 USD