protein

Recombinant Human MIG (CXCL9)

MBS142040

0.02 mg

205 USD

Recombinant Protein

Recombinant Human MIG (CXCL9)

MIG

MIG Human; MIG Human Recombinant (CXCL9); Small inducible cytokine B9; CXCL9; Gamma interferon-induced monokine; MIG; chemokine (C-X-C motif) ligand 9; CMK; Humig; SCYB9; crg-10; monokine induced by gamma-interferon

C-X-C motif chemokine 9; C-X-C motif chemokine 9; C-X-C motif chemokine 9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; small-inducible cytokine B9; chemokine (C-X-C motif) ligand 9; Gamma-interferon-induced monokine; Monokine induced by interferon-gamma; HuMIG; MIG; Small-inducible cytokine B9

MIG

CXCL9; CXCL9; CMK; MIG; Humig; SCYB9; crg-10; CMK; MIG; SCYB9; HuMIG; MIG

CXCL9_HUMAN

E Coli

125

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKI
EIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQK
NGKKHQKKKVLKVRKSQRSRQKKTT.

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl. Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CXCL9 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Solubility: It is recommended to reconstitute the lyophilized MIG in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

CHEMOKINES; Chemokines; MIG (CXCL9)

Description: MIG (monokine induced by gamma-interferon) Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques. Introduction: Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG). CXCL9 is a T-cell chemoattractant, which is induced by IFN-?. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

4505187

NP_002407.1

NM_002416.2

Q07325

14,019 Da

CXCR3-mediated Signaling Events Pathway 138011!!Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway 1127664!!Disease Pathway 530764!!G Alpha (i) Signalling Events Pathway 119550

This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014]

0.02 mg

205 USD