Recombinant Human HCC-1 (CCL14) | MyBioSource MBS142020 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human HCC-1 (CCL14)

catalog :

MBS142020

quantity :

0.002 mg

price :

140 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS142020

products type :

Recombinant Protein

products full name :

Recombinant Human HCC-1 (CCL14)

products short name :

HCC-1

products name syn :

HCC 1 Human; HCC-1 Human Recombinant (CCL14); Small inducible cytokine A14; CCL14; Chemokine CC-1/CC-3; HCC-1/HCC-3; HCC-1(1-74); NCC-2; chemokine (C-C motif) ligand 14; CC-1; CC-3; CKb1; MCIF; SY14; HCC-1; HCC-3; SCYL2; SCYA14

other names :

C-C motif chemokine 14 isoform 2; C-C motif chemokine 14; C-C motif chemokine 14; chemokine CC-1/CC-3; chemokine CC-3; hemofiltrate CC chemokine 1; new CC chemokine 2; small inducible cytokine subfamily A (Cys-Cys), member 14; small-inducible cytokine A14; chemokine (C-C motif) ligand 14; Chemokine CC-1/CC-3; HCC-1/HCC-3; HCC-1(1-74); NCC-2; Small-inducible cytokine A14Cleaved into the following 3 chains:HCC-1(3-74); HCC-1(4-74); HCC-1(9-74)

products gene name :

HCC 1

other gene names :

CCL14; CCL14; CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; NCC2; SCYA14; HCC-1/HCC-3

uniprot entry name :

CCL14_HUMAN

host :

E Coli

sequence length :

109

sequence :

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCS
KPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN.

purity :

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

form :

The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl. Sterile Filtered White lyophilized (freeze-dried) powder.

storage stability :

Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CCL14 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

other info2 :

Solubility: It is recommended to reconstitute the lyophilized HCC-1 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000IU/mg.

products categories :

CHEMOKINES; Chemokines; HCC-1

products description :

Description: HCC-1 Human Recombinant produced in E Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton. The HCC-1 is purified by proprietary chromatographic techniques. Introduction: Chemokine (C-C motif) ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It is also commonly known as HCC-1. It is produced as a protein precursor that is procesed to generate a mature active protein containing 74 amino acids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed in various tissues including spleen, bone marrow, liver, muscle, and gut. CCL13 activates monocytes, but does not induce their chemotaxis. Human CCL13 is located on chromosome 17 within a cluster of other chemokines belonging to the CC family.

ncbi gi num :

14589959

ncbi acc num :

NP_116738.1

ncbi gb acc num :

NM_032962.4

uniprot acc num :

Q16627

ncbi mol weight :

12,297 Da

ncbi pathways :

Chemokine Signaling Pathway (99051); Chemokine Signaling Pathway (96864); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460)

ncbi summary :

This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009]

uniprot summary :

CCL14: Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. Belongs to the intercrine beta (chemokine CC) family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 17q12. Cellular Component: extracellular space. Molecular Function: chemokine activity. Biological Process: cellular calcium ion homeostasis; positive regulation of cell proliferation; immune response

size1 :

0.002 mg

price1 :

140 USD

size2 :

0.01 mg

price2 :

205

size3 :

1 mg

price3 :

2665

more info or order :

MyBioSource product webpage