catalog number :
MBS142003
products type :
Recombinant Protein
products full name :
Recombinant Der P1 Protein
products short name :
Der P1
products name syn :
Der P1; Der P1 Protein Recombinant; Peptidase 1; Major mite fecal allergen Der p 1; Allergen Der p I; Der p 1; DERP1; Der-P1
other names :
Peptidase 1; Peptidase 1; Allergen Der p I; Major mite fecal allergen Der p 1; Allergen: Der p 1
products gene name :
Der-1
uniprot entry name :
PEPT1_DERPT
sequence :
MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQS
NGGAINHLSDLSLDEFKNRFLMSAEAFEHLKTQFDLNAE
TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFSG
VAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPR
GIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYC
QIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGR
TIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTN
WGDNGYGYFAANIDLMMIEEYPYVVILHHHHHH
purity :
Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining). Purified by proprietary chromatographic technique.
form :
(1mg/ml) 60mM NaCl, 50mM Tris-HCl pH 8.0 and 1.2M Urea.
storage stability :
Der-P1 although stable at 4 degree C for 1 week, should be stored below -18 degree C. Please prevent freeze thaw cycles.
products categories :
ALLERGY PROTEINS; Recombinant Proteins; Allergy
products description :
Description: The E,Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a,a, 20-320) (lnd fused to a 6 His Tag at C-terminus, having a total MW of 34.8kDa, pl 5,8,. Introduction: DERP1 is a thiol protease, with a preference for substrates with a large hydrophobic side chain in the P2 position, or with basic residues. DERP1 is a C1 peptidase family member. DERP1 has extensive endopeptidase specificity. DERP1 is N-glycosylated. N-glycanase treatment does not completely remove carbohydrates, suggesting that the protein contains additional glycosylation sites. DERP1 causes an allergic reaction in humans. Common symptoms of mite allergy are bronchial asthma, allergic rhinitis and conjunctivitis. DERP1 binds to IgE in 80% of patients with house dust allergy.
ncbi mol weight :
36,104 Da