catalog number :
MBS1417080
products type :
Recombinant Protein
products full name :
Recombinant Human Syncytin-1
products short name :
Syncytin-1
products name syn :
Endogenous retrovirus group W member 1; Env-W; Envelope polyprotein gPr73; Enverin; HERV-7q Envelope protein; HERV-W envelope protein; HERV-W_7q21.2 provirus ancestral Env polyprotein; Syncytin; Surface protein; SU; gp50; Transmembrane protein; TM; gp24
other names :
syncytin-1; Syncytin-1; syncytin-1; endogenous retrovirus group W member 1; Endogenous retrovirus group W member 1; Env-W; Envelope polyprotein gPr73; Enverin; HERV-7q Envelope protein; HERV-W envelope protein; HERV-W_7q21.2 provirus ancestral Env polyprotein; Syncytin
products gene name :
ERVW-1
other gene names :
ERVW-1; ERVW-1; ENV; ENVW; HERVW; ERVWE1; HERV7Q; HERV-7q; HERVWENV; HERV-W-ENV; ERVWE1; SU; TM
uniprot entry name :
SYCY1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-443; Extracellular domain
sequence :
YHSATLCMHANTHYWTGKMINPSCPGGLGVTVCWTYFTQTGMSDGGGVQDQ AREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEV SAQNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINTTSVLVGPLVSNLEITHTS NLTCVKFSNTTYTTNSQCIRWVTPPTQIVCLPSGIFFVCGTSAYRCLNGSSESMC FLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQ FYYKLSQELNGDMERVADSLVTLQDQLNSLAAVVLQNRRALDLLTAERGGTCL FLGEECCYYVNQSGIVTEKVKEIRDRIQRRAEELRNTGPWGLLSQ
APPPCRCMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGT
PTFTAHTHMPRNC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Cell Biology
products description :
This endogenous retroviral envelope protein has retained its original fusogenic properties and participates in trophoblast fusion and the formation of a syncytium during placenta morphogenesis. May induce fusion through binding of SLC1A4 and SLC1A5 (PubMed:10708449, PubMed:12050356, PubMed:23492904). Endogenous envelope proteins may have kept, lost or modified their original function during evolution. Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. The surface protein (SU) mediates receptor recognition, while the transmembrane protein (TM) acts as a class I viral fusion protein. The protein may have at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of membranes.
products references :
Molecular characterization and placental expression of HERV-W, a new human endogenous retrovirus family."
Blond J.-L., Beseme F., Duret L., Bouton O., Bedin F., Perron H., Mandrand B., Mallet F.
J. Virol. 73:1175-1185(1999)
ncbi acc num :
NP_001124397.1
ncbi gb acc num :
NM_001130925.1
ncbi mol weight :
63.01kd
ncbi summary :
Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The gene's protein product is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010]
uniprot summary :
ERVWE1: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has retained its original fusogenic properties and participates in trophoblast fusion during placenta morphogenesis. Belongs to the gamma type-C retroviral envelope protein family. HERV class-I W env subfamily. Protein type: Membrane protein, integral; Cell surface. Chromosomal Location of Human Ortholog: 7q21.2. Cellular Component: integral to membrane; plasma membrane; viral envelope. Biological Process: anatomical structure morphogenesis; syncytium formation
size5 :
0.05 mg (Baculovirus)