catalog number :
MBS1416732
products type :
Recombinant Protein
products full name :
Recombinant Arabidopsis thaliana (Mouse-ear cress) Sucrose-phosphate synthase 1
products short name :
Sucrose-phosphate synthase 1
products name syn :
Sucrose-phosphate synthase 1F; AtSPS1F; Sucrose-phosphate synthase 5.1; AtSPS5.1; UDP-glucose-fructose-phosphate glucosyltransferase
other names :
sucrose phosphate synthase 1F; Sucrose-phosphate synthase 1; sucrose phosphate synthase 1F; Sucrose-phosphate synthase 1F; AtSPS1F; Sucrose-phosphate synthase 5.1; AtSPS5.1; UDP-glucose-fructose-phosphate glucosyltransferase
products gene name :
SPS1
other gene names :
SPS1F; SPS1; ATSPS1F; F5O24.170; F5O24_170; SPS1F; sucrose phosphate synthase 1F; SPSA1; AtSPS1F; AtSPS5.1
uniprot entry name :
SPSA1_ARATH
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
768-995
sequence :
VVIALDFDGEEDTLEATKRILDAVEKERAEGSVGFILST
SLTISEVQSFLVSGGLNPNDFDAFICNSGSDLHYTSLNN
EDGPFVVDFYYHSHIEYRWGGEGLRKTLIRWASSLNEKK
ADNDEQIVTLAEHLSTDYCYTFTVKKPAAVPPVRELRKL
LRIQALRCHVVYSQNGTRINVIPVLASRIQALRYLFVRW
GIDMAKMAVFVGESGDTDYEGLLGGLHKSVVLK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Arabidopsis thaliana (Mouse-ear cress)
products categories :
Signal Transduction
products description :
Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation. Required for nectar secretion.
products references :
Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana."
Tabata S., Kaneko T., Nakamura Y., Kotani H., Kato T., Asamizu E., Miyajima N., Sasamoto S., Kimura T., Hosouchi T., Kawashima K., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Naruo K. Fransz P.F.
Nature 408:823-826(2000)
ncbi acc num :
NP_197528.1
ncbi gb acc num :
NM_122035.2
ncbi mol weight :
41.49kD
ncbi pathways :
Metabolic Pathways (132014); Seed Development Pathway (755444); Seed Development Pathway (755443); Starch And Sucrose Metabolism Pathway (4033); Starch And Sucrose Metabolism Pathway (344)
size5 :
0.05 mg (Baculovirus)