protein

Recombinant Mouse C-type lectin domain family 4 member E (Clec4e)

MBS1408349

0.01 mg (E-Coli)

235 USD

Recombinant Protein

Recombinant Mouse C-type lectin domain family 4 member E (Clec4e)

[C-type lectin domain family 4 member E (Clec4e)]

[C-type lectin domain family 4 member E; C-type lectin superfamily member 9; Macrophage-inducible C-type lectin]

[C-type lectin domain family 4 member E; C-type lectin domain family 4 member E; C-type lectin domain family 4 member E; C-type lectin superfamily member 9; macrophage-inducible C-type lectin; C-type lectin, superfamily member 9; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9; C-type lectin domain family 4, member e; C-type lectin superfamily member 9; Macrophage-inducible C-type lectin]

[Clec4e]

[Clec4e; Clecsf9; Mincle]

[Clec4e; Clec4e; C86253; Mincle; Clecsf9; Clecsf9; Mincle]

CLC4E_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

[46-214aa; Extracellular Domain]

169

TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNW
KHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEE
QEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESL
SFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSM
PWICEMPEISPLD

>=90%

Liquid containing glycerol

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Species: Mus musculus (Mouse)

Immunology

C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B.

9910162

NP_064332.1

NM_019948.2

Q9R0Q8

24,431 Da

Tuberculosis Pathway (213781); Tuberculosis Pathway (213743)

CLEC4E: C-type lectin that functions as cell-surface receptor for a wide variety of ligands such as damaged cells, fungi and mycobacteria. Plays a role in the recognition of pathogenic fungi, such as Candida albicans. The detection of mycobacteria is via trehalose 6,6 -dimycolate (TDM), a cell wall glycolipid. Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia. Recognizes also SAP130, a nuclear protein, that is released by dead or dying cells. Transduces signals through an ITAM-containing adapter protein, Fc receptor gamma chain /FCER1G. Induces secretion of inflammatory cytokines through a pathway that depends on SYK, CARD9 and NF-kappa-B. Protein type: Receptor, misc.; Membrane protein, integral. Cellular Component: membrane; integral to membrane. Molecular Function: protein binding; receptor activity; carbohydrate binding. Biological Process: immune system process; immune response; positive regulation of cytokine secretion

0.01 mg (E-Coli)

235 USD

0.05 mg (E-Coli)

320

0.1 mg (E-Coli)

535

0.2 mg (E-Coli)

855

0.5 mg (E-Coli)

1125

1 mg (E-Coli)

1725