WVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVS
GTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLG
QFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFY
LPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVD
LDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLD
VVKIPFLPLYITTCNNPKLPT

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC
- Recombinant Human Keratin, type I cuticular Ha5 | MBS1414251
- Recombinant Arachis hypogaea (Peanut) Conglutin | MBS1415723
- Recombinant Human Thrombospondin type-1 domain-containing protein 7A (THSD7A), p ...
- Mouse beta Nerve Growth Factor | MBS142316