catalog number :
MBS140566
products type :
Recombinant Protein
products full name :
Recombinant Human B-Raf Proto-Oncogene
products short name :
[B-Raf Proto-Oncogene]
products name syn :
[BRAF Human; B-Raf Proto-Oncogene Human Recombinant; B-Raf Proto-Oncogene; Serine/Threonine Kinase; V-Raf Murine Sarcoma Viral Oncogene Homolog B1; V-Raf Murine Sarcoma Viral Oncogene Homolog B; Proto-Oncogene B-Raf; BRAF1; RAFB1; NS7; B-Raf Proto-Oncogene Serine/Threonine-Protein Kinase (P94); Murine Sarcoma Viral (V-Raf) Oncogene Homolog B1; Serine/Threonine-Protein Kinase B-Raf; 94 KDa B-Raf Protein; EC 2.7.11.1; B-RAF1; P94; Serine/threonine-protein kinase B-raf; Proto-oncogene B-Raf; p94; v-Raf murine sarcoma viral oncogene homolog B1]
other names :
[serine/threonine-protein kinase B-raf; Serine/threonine-protein kinase B-raf; serine/threonine-protein kinase B-raf; B-Raf proto-oncogene, serine/threonine kinase; Proto-oncogene B-Raf; p94; v-Raf murine sarcoma viral oncogene homolog B1]
products gene name :
[BRAF]
other gene names :
[BRAF; BRAF; NS7; BRAF1; RAFB1; B-RAF1; BRAF1; RAFB1]
uniprot entry name :
BRAF_HUMAN
sequence :
SEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGT
VYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTR
HVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKF
EMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHED
LTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIR
MQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQI
IFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDER
PLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDF
SLYACASPKTPIQAGGYGAFPVH
MGSSHHHHHH SSGLVPRGSHMGSEF
purity :
Greater than 80.0% as determined by SDS-PAGE.
form :
BRAF protein solution (0.25mg/ml) containing 20mM Tris-HCl (pH8.0) and 10% glycerol.
storage stability :
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
other info1 :
Physical Appearance: Sterile Filtered colorless solution.
products categories :
PROTEIN KINASES
products description :
BRAF Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 360 amino acids (432-766a.a) and having a molecular mass of 40.6kDa. BRAF is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
ncbi acc num :
NP_004324.2
ncbi gb acc num :
NM_004333.4
ncbi pathways :
ARMS-mediated Activation Pathway (1269471); Activation Of NMDA Receptor Upon Glutamate Binding And Postsynaptic Events Pathway (1268798); Acute Myeloid Leukemia Pathway (83117); Acute Myeloid Leukemia Pathway (529); Alcoholism Pathway (585563); Alcoholism Pathway (587116); Axon Guidance Pathway (1270303); B Cell Receptor Signaling Pathway (198909); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527)
uniprot summary :
BRAF: a tyrosine kinase-like kinase of the RAF family. Involved in the transduction of mitogenic signals from the cell membrane to the nucleus. May play a role in the postsynaptic responses of hippocampal neuron. Frequently mutated in thyroid cancers, skin melanomas and at lower frequency in a wide range of human cancers. An activating mutation, mimicking phosphorylation of the activation loop, is seen in 60% of malignant melanoma samples. Raf mutations are generally exclusive to Ras activating mutations. Activating mutations are also seen in ~10% of colorectal cancers, in lung cancers and gliomas, and at a lower rate in several other tumors. Inactivating mutations are also seen and may result in activation of c-Raf and Erk. Mutations in B-Raf, MEK1 and MEK2 also associated with cardiofaciocutaneous syndrome, displaying morphological, cardiac and mental defects. Approved Inhibitor: Nexavar/Sorafenib. Protein type: EC 2.7.11.1; Kinase, protein; Oncoprotein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; RAF family; TKL group. Chromosomal Location of Human Ortholog: 7q34. Cellular Component: cytoplasm; cytosol; intracellular; intracellular membrane-bound organelle; plasma membrane. Molecular Function: calcium ion binding; identical protein binding; MAP kinase kinase kinase activity; mitogen-activated protein kinase kinase binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; small GTPase binding. Biological Process: cell differentiation; glucose transport; MAPKKK cascade; negative regulation of apoptosis; negative regulation of signal transduction; organ morphogenesis; positive regulation of peptidyl-serine phosphorylation; protein amino acid phosphorylation. Disease: Cardiofaciocutaneous Syndrome 1; Leopard Syndrome 3; Lung Cancer; Noonan Syndrome 1; Noonan Syndrome 7