product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Group XV phospholipase A2 (Pla2g15)
catalog :
MBS1403139
quantity :
0.01 mg (E-Coli)
price :
200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1403139
products type :
Recombinant Protein
products full name :
Recombinant Mouse Group XV phospholipase A2 (Pla2g15)
products short name :
[Group XV phospholipase A2 (Pla2g15)]
other names :
[group XV phospholipase A2 isoform 1; Group XV phospholipase A2; group XV phospholipase A2; phospholipase A2, group XV; 1-O-acylceramide synthase]
products gene name :
[Pla2g15]
products gene name syn :
[Pla2g15]
other gene names :
[Pla2g15; Pla2g15; ACS; LLPL; Lpla2; C87498; Lypla3; Lypla3; LPLA2]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[34-412aa; Full Length of Mature Protein]
sequence length :
412
sequence :
AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSY
FTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGV
DVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGY
TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYG
GPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGA
PWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTS
WLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFED
GWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYE
SFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSL
QELPGSEHIEMLANATTLAYLKRVLLEP
purity :
Greater than 85% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mus musculus (Mouse)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Epigenetics and Nuclear Signaling
products description :
Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid. Has high activity with 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) and 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), catalyzing the transfer of oleic acid to N-acetyl-sphingosine. Required for normal phospholipid degradation in alveolar and peritoneal macrophages and in spleen
products references :
The measurement of lysosomal phospholipase A2 activity in plasma." Abe A., Kelly R., Shayman J.A. J. Lipid Res. 51:2464-2470(2010)
ncbi gi num :
19527008
ncbi acc num :
NP_598553.1
ncbi gb acc num :
NM_133792.3
uniprot acc num :
Q8VEB4
ncbi mol weight :
50.5 kDa
ncbi pathways :
Glycerophospholipid Metabolism Pathway (83188); Glycerophospholipid Metabolism Pathway (364); Lysosome Pathway (99272); Lysosome Pathway (96865)
uniprot summary :
Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid (PubMed:11790796, PubMed:16106046, PubMed:16880524, PubMed:19017977, PubMed:20410020). Has high activity with 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) and 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), catalyzing the transfer of oleic acid to N-acetyl-sphingosine (PubMed:16880524). Required for normal phospholipid degradation in alveolar and peritoneal macrophages and in spleen (PubMed:16880524, PubMed:19017977).
size1 :
0.01 mg (E-Coli)
price1 :
200 USD
size2 :
0.05 mg (E-Coli)
price2 :
260
size3 :
0.1 mg (E-Coli)
price3 :
430
size4 :
0.2 mg (E-Coli)
price4 :
685
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!