Recombinant Human Hepatocellular carcinoma-associated protein TD26 | MyBioSource MBS1402998 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Hepatocellular carcinoma-associated protein TD26

catalog :

MBS1402998

quantity :

0.01 mg (E-Coli)

price :

160 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1402998

products type :

Recombinant Protein

products full name :

Recombinant Human Hepatocellular carcinoma-associated protein TD26

products short name :

[Hepatocellular carcinoma-associated protein TD26]

products name syn :

[Betatrophin1]

other names :

[angiopoietin-like protein 8; Angiopoietin-like protein 8; angiopoietin-like protein 8; angiopoietin like 8; Betatrophin]

products gene name :

[C19orf80]

other gene names :

[ANGPTL8; ANGPTL8; RIFL; TD26; PRO1185; PVPA599; C19orf80]

uniprot entry name :

ANGL8_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[22-198aa; Full Length of Mature Protein]

sequence length :

198

sequence :

APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRL
TKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQ
MEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLR
SAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREM
VAQQHRLRQIQERLHTAALPA

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

image1 heading :

SDS-PAGE

other info2 :

Production Note: Special Offer: The Baculovirus, E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products categories :

Cell Biology

products description :

Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels. May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state.

products references :

Identification of genes differentially expressed in human hepatocellular carcinoma by a modified suppression subtractive hybridization method.Dong X.Y., Pang X.W., Yu S.T., Su Y.R., Wang H.C., Yin Y.H., Wang Y.D., Chen W.F.Int. J. Cancer 112:239-248(2004) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)

ncbi gi num :

291219911

ncbi acc num :

NP_061157.3

ncbi gb acc num :

NM_018687.6

uniprot acc num :

Q6UXH0

ncbi mol weight :

24kD

uniprot summary :

EG624219: Hormone that specifically promotes pancreatic beta cell proliferation and beta cell mass expansion, thereby improving glucose tolerance. Promotes pancreatic beta cell proliferation without insulin resistance. Also acts as a blood lipid regulator by regulating serum triglyceride levels; possibly by promoting ANGPTL3 cleavage. In response to food intake. Interacts with ANGPTL3. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 19p13.2. Cellular Component: extracellular region. Molecular Function: hormone activity; protein binding. Biological Process: cell maturation; cellular lipid metabolic process; fat cell differentiation; regulation of lipid metabolic process; regulation of lipoprotein metabolic process

size1 :

0.01 mg (E-Coli)

price1 :

160 USD

size2 :

0.05 mg (E-Coli)

price2 :

200

size3 :

0.01 mg (Baculovirus)

price3 :

235

size4 :

0.1 mg (E-Coli)

price4 :

295

size5 :

0.02 mg (Baculovirus)

price5 :

355

size6 :

0.2 mg (E-Coli)

price6 :

480

size7 :

0.05 mg (Baculovirus)

price7 :

680

size8 :

0.5 mg (E-Coli)

price8 :

790

size9 :

0.1 mg (Baculovirus)

price9 :

940

size10 :

1 mg (E-Coli)

price10 :

1215

size11 :

0.5 mg (Baculovirus)

price11 :

1325

size12 :

1 mg (Baculovirus)

price12 :

1845

more info or order :

MyBioSource product webpage