catalog number :
MBS1401532
products type :
Recombinant Protein
products full name :
Recombinant Human Pleckstrin homology-like domain family A member 1 (PHLDA1)
products short name :
[Pleckstrin homology-like domain family A member 1 (PHLDA1)]
other names :
[pleckstrin homology-like domain family A member 1; Pleckstrin homology-like domain family A member 1; pleckstrin homology-like domain family A member 1; pleckstrin homology like domain family A member 1; Apoptosis-associated nuclear protein; Proline- and glutamine-rich protein; PQ-rich protein; PQR protein; Proline- and histidine-rich protein; T-cell death-associated gene 51 protein]
products gene name :
[PHLDA1]
products gene name syn :
[PHLDA1]
other gene names :
[PHLDA1; PHLDA1; PHRIP; TDAG51; DT1P1B11; PHRIP; TDAG51; PQ-rich protein; PQR protein]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-401aa, Full Length]
sequence :
MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPI
QKRREGARPVPFSERSQEDGRGPAARSSGTLWRIRTRLS
LCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLL
LLPPARAAGNGEAEPSGGPSYAGRMLESSGCKALKEGVL
EKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQHQQQQQQ
QQQQQQQQQPGQGPAEPSQPSGPAVASLEPPVKLKELHF
SNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWN
AEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQPPSQPQ
PQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHPY
PHPHPHPHSHPHSHPHPHPHPHPHQIPHPHPQPHSQPHG
HRLLRSTSNSA
purity :
Greater than 85% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
products categories :
Cell Biology
products description :
Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in translational regulation.
products references :
Assignment of the human PHLDA1 gene to chromosome 12q15 by radiation hybrid mapping." Kuske M.D., Johnson J.P. Cytogenet. Cell Genet. 89:1-1(2000)
ncbi acc num :
NP_031376.3
ncbi gb acc num :
NM_007350.3
ncbi mol weight :
50.5 kDa
ncbi summary :
This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1. [provided by RefSeq, Jul 2008]
uniprot summary :
Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in translational regulation.