catalog number :
MBS1399508
products type :
Recombinant Protein
products full name :
Recombinant Rat Sclerostin domain-containing protein 1 (Sostdc1)
products short name :
[Sclerostin domain-containing protein 1 (Sostdc1)]
other names :
[sclerostin domain-containing protein 1; Sclerostin domain-containing protein 1; sclerostin domain-containing protein 1; sclerostin domain containing 1; Uterine sensitization-associated gene 1 protein; USAG-1; Wnt-signaling modulator]
products gene name :
[Sostdc1]
products gene name syn :
[Sostdc1]
other gene names :
[Sostdc1; Sostdc1; Wise; Usag1; Usag-1; Usag1; Wise; USAG-1]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[24-206. Full Length of Mature Protein]
sequence :
FKNDATEILYSHVVKPVSAHPSSNSTLNQARNGGRHFSS
TGLDRNSRVQVGCRELRSTKYISDGQCTSISPLKELVCA
GECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRT
QRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNF
ESVSPAKPAQHHRERKRASKSSKHSLS
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Rat
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The Baculovirus, Mammalian-Cell host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, Mammalian-Cellhost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, Mammalian-Cell host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, Mammalian-Cell host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
This gene is a member of the sclerostin family and encodes an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with BMPs, prohibiting them from binding their receptors, thereby regulating BMP signaling during cellular proliferation, differentiation, and programmed cell death.
ncbi acc num :
NP_714959.1
ncbi gb acc num :
NM_153737.1
ncbi mol weight :
23,136 Da
ncbi summary :
may be involved in the onset of endometrial receptivity for implantation/sensitization [RGD, Feb 2006]
uniprot summary :
Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner (). May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. Enhances Wnt signaling and inhibits TGF-beta signaling.
size2 :
0.01 mg (Mammalian-Cell)
size3 :
0.01 mg (Baculovirus)
size5 :
0.02 mg (Mammalian-Cell)
size6 :
0.02 mg (Baculovirus)
size8 :
0.05 mg (Mammalian-Cell)
size9 :
0.05 mg (Baculovirus)
size11 :
0.05 mg (E-Coli)
size12 :
0.1 mg (Mammalian-Cell)
size13 :
0.1 mg (Baculovirus)
size16 :
0.5 mg (Baculovirus)
size18 :
1 mg (Baculovirus)