catalog number :
MBS1394494
products type :
Recombinant Protein
products full name :
Recombinant Rat Fibroblast growth factor 23 (Fgf23)
products short name :
[Fibroblast growth factor 23 (Fgf23)]
other names :
[fibroblast growth factor 23; Fibroblast growth factor 23; fibroblast growth factor 23; fibroblast growth factor 23]
products gene name :
[Fgf23]
other gene names :
[Fgf23; Fgf23; FGF-23]
uniprot entry name :
FGF23_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[25-251. Full Length of Mature Protein]
sequence :
YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDG
TPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNI
FGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRS
KRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRS
AEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPA
ASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
products references :
Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006)
The parathyroid is a target organ for FGF23 in rats.Ben-Dov I.Z., Galitzer H., Lavi-Moshayoff V., Goetz R., Kuro-o M., Mohammadi M., Sirkis R., Naveh-Many T., Silver J.J. Clin. Invest. 117:4003-4008(2007)
ncbi acc num :
NP_570110.1
ncbi gb acc num :
NM_130754.1
ncbi pathways :
ARMS-mediated Activation Pathway (1333867); Adaptive Immune System Pathway (1332755); Axon Guidance Pathway (1333217); Cytokine Signaling In Immune System Pathway (1332884); DAP12 Interactions Pathway (1332858); DAP12 Signaling Pathway (1332859); Developmental Biology Pathway (1333216); Downstream Signal Transduction Pathway (1333874); Downstream Signaling Events Of B Cell Receptor (BCR) Pathway (1332769); Downstream Signaling Of Activated FGFR1 Pathway (1333792)
uniprot summary :
Regulator of phosphate homeostasis (). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (). Regulator of vitamin-D metabolism (). Negatively regulates osteoblasts differentiation and matrix mineralization (). Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
size9 :
0.05 mg (Baculovirus)
size12 :
0.05 mg (Mammalian-Cell)
size13 :
0.1 mg (Baculovirus)
size16 :
0.5 mg (Baculovirus)
size17 :
0.1 mg (Mammalian-Cell)
size18 :
1 mg (Baculovirus)