product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Thymic stromal lymphopoietin
catalog :
MBS1393144
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1393144
products type :
Recombinant Protein
products full name :
Recombinant Human Thymic stromal lymphopoietin
products short name :
Thymic stromal lymphopoietin
products name syn :
Homo sapiens (Human)
other names :
thymic stromal lymphopoietin isoform 1; Thymic stromal lymphopoietin; thymic stromal lymphopoietin; thymic stromal lymphopoietin
products gene name :
TSLP
other gene names :
TSLP; TSLP
uniprot entry name :
TSLP_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
29-159
sequence length :
159
sequence :
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTV
SCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAAL
AIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQ
GLWRRFNRPLLKQQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Immunology
products description :
Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.
products references :
Human thymic stromal lymphopoietin preferentially stimulates myeloid cells." Reche P.A., Soumelis V., Gorman D.M., Clifford T., Liu M.-R., Travis M., Zurawski S.M., Johnston J., Liu Y.-J., Spits H., de Waal Malefyt R., Kastelein R.A., Bazan J.F. J. Immunol. 167:336-343(2001)
ncbi gi num :
14719428
ncbi acc num :
NP_149024.1
ncbi gb acc num :
NM_033035.4
uniprot acc num :
Q969D9
ncbi mol weight :
30.92kD
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Jak-STAT Signaling Pathway (83077); Jak-STAT Signaling Pathway (488); TSLP Signaling Pathway (672451)
ncbi summary :
This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
uniprot summary :
TSLP: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 5q22.1. Cellular Component: extracellular space. Molecular Function: cytokine activity
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.05 mg (E-Coli)
price2 :
190
size3 :
0.02 mg (Mammalian-Cell)
price3 :
295
size4 :
0.2 mg (E-Coli)
price4 :
460
size5 :
0.05 mg (Mammalian-Cell)
price5 :
575
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!