product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Mixed lineage kinase domain-like protein
catalog :
MBS1379843
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1379843
products type :
Recombinant Protein
products full name :
Recombinant Mouse Mixed lineage kinase domain-like protein
products short name :
Mixed lineage kinase domain-like protein
other names :
mixed lineage kinase domain-like protein isoform 1; Mixed lineage kinase domain-like protein; mixed lineage kinase domain-like protein; mixed lineage kinase domain-like
products gene name :
Mlkl
other gene names :
Mlkl; Mlkl; 9130019I15Rik
uniprot entry name :
MLKL_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-472
sequence length :
472
sequence :
MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLL
QPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKF
SKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQV
YHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQ
ISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPW
TKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRF
TFNDEIKTMKKFDSPNILRIF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process. Activated following phosphorylation by RIPK3, leading to homotrimerization, localization to the plasma membrane and execution of programmed necrosis characterized by calcium influx and plasma membrane damage. Does not have protein kinase activity.
ncbi gi num :
890787599
ncbi acc num :
NP_001297542.1
ncbi gb acc num :
NM_001310613.1
uniprot acc num :
Q9D2Y4
ncbi mol weight :
56.3kD
ncbi pathways :
Programmed Cell Death Pathway (1323523); RIPK1-mediated Regulated Necrosis Pathway (1323556); Regulated Necrosis Pathway (1323555); TNF Signaling Pathway (812263); TNF Signaling Pathway (813210)
ncbi summary :
This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2015]
uniprot summary :
MLKL: Belongs to the protein kinase superfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Kinase, protein; Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); TKL group; TKL-Unique family. Cellular Component: cytoplasm; membrane; plasma membrane. Molecular Function: ATP binding; nucleotide binding; protein complex binding; protein kinase activity; protein kinase binding. Biological Process: programmed cell death; protein amino acid phosphorylation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
size5 :
0.05 mg (Baculovirus)
price5 :
1255
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!