catalog number :
MBS1376561
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta Interleukin-2 (IL2)
products short name :
[Interleukin-2 (IL2)]
products name syn :
[Interleukin-2; IL-2; T-cell growth factor; TCGF]
other names :
[interleukin-2; Interleukin-2; interleukin-2; TCGF; T-cell growth factor; T-cell growth factor; TCGF]
products gene name :
[IL2]
other gene names :
[IL2; IL2; IL-2; IL-2; TCGF]
uniprot entry name :
IL2_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[21-154. Full Length of Mature Protein]
sequence :
APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRM
LTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNF
HLRDTKDLISNINVIVLELKGSETTLMCEYADETATIVE
FLNRWITFCQSIISTLT
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Macaca mulatta (Rhesus macaque)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Immunology
products description :
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
ncbi acc num :
NP_001040595.1
ncbi gb acc num :
NM_001047130.1
ncbi mol weight :
17,685 Da
ncbi pathways :
Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Autoimmune Thyroid Disease Pathway (86787); Autoimmune Thyroid Disease Pathway (533); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); Graft-versus-host Disease Pathway (86790); Graft-versus-host Disease Pathway (536)
uniprot summary :
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells ().
size6 :
0.05 mg (Baculovirus)
size10 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)