FKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPL
TFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSF
QPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKGLCSH

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Mouse Mixed lineage kinase domain-like protein | MBS1379843
- Recombinant Enterococcus faecalis Gelatinase (gelE) | MBS1380829
- Recombinant Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) ...
- Recombinant Human Thymic stromal lymphopoietin | MBS1393144
- Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase