Recombinant Human Myosin-binding protein C, fast-type | MyBioSource MBS1371988 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Myosin-binding protein C, fast-type

catalog :

MBS1371988

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1371988

products type :

Recombinant Protein

products full name :

Recombinant Human Myosin-binding protein C, fast-type

products short name :

Myosin-binding protein C

products name syn :

C-protein, skeletal muscle fast isoform

other names :

myosin-binding protein C, fast-type; Myosin-binding protein C, fast-type; myosin-binding protein C, fast-type; myosin binding protein C, fast type; C-protein, skeletal muscle fast isoform

products gene name :

MYBPC2

other gene names :

MYBPC2; MYBPC2; MYBPC; MYBPCF; MYBPCF; Fast MyBP-C

uniprot entry name :

MYPC2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

739-1141

sequence length :

1141

sequence :

EPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCL
EGSEEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNI
AGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG
EQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFD
TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKA
GPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKA
DKKTMEWFNVYERNRHTSCTV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.

products references :

Complete sequence of human fast-type and slow-type muscle myosin-binding-protein C (MyBP-C) . Differential expression, conserved domain structure and chromosome assignment.Weber F.E., Vaughan K.T., Reinach F.C., Fischman D.A.Eur. J. Biochem. 216:661-669(1993) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)

ncbi gi num :

133908641

ncbi acc num :

NP_004524.3

ncbi gb acc num :

NM_004533.3

uniprot acc num :

Q14324

ncbi mol weight :

47.5kD

ncbi pathways :

Muscle Contraction Pathway (1269868); Striated Muscle Contraction Pathway (1269869); Striated Muscle Contraction Pathway (198903)

ncbi summary :

This gene encodes a member of the myosin-binding protein C family. This family includes the fast-, slow- and cardiac-type isoforms, each of which is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. The protein encoded by this locus is referred to as the fast-type isoform. Mutations in the related but distinct genes encoding the slow-type and cardiac-type isoforms have been associated with distal arthrogryposis, type 1 and hypertrophic cardiomyopathy, respectively. [provided by RefSeq, Jul 2012]

uniprot summary :

MYBPC2: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Belongs to the immunoglobulin superfamily. MyBP family. Protein type: Myosin-binding. Chromosomal Location of Human Ortholog: 19q13.33. Cellular Component: cytosol. Molecular Function: actin binding; protein binding; structural constituent of muscle. Biological Process: cell adhesion; muscle filament sliding

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

1 mg (E-Coli)

price4 :

1180

more info or order :

MyBioSource product webpage