PNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLL
GDIAADYHKQSHGAAPCSGGSQ

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Oligodendrocyte transcription factor 2 | MBS1371789
- Recombinant Staphylococcus aureus Clumping factor B | MBS1378726
- Recombinant Mouse Putative ribosomal RNA methyltransferase NOP2 (Nop2)
- Recombinant Staphylococcus aureus Staphylococcal secretory antigen ssaA1
- Recombinant Human Sal-like protein 2 (SALL2),partial | MBS1394742