catalog number :
MBS1366759
products type :
Recombinant Protein
products full name :
Recombinant Mouse Cystathionine beta-synthase
products short name :
Cystathionine beta-synthase
products name syn :
Beta-thionase; Serine sulfhydrase
other names :
cystathionine beta-synthase isoform 2; Cystathionine beta-synthase; cystathionine beta-synthase; cystathionine beta-synthase; Beta-thionase; Serine sulfhydrase
other gene names :
Cbs; Cbs; HIP4; AI047524; AI303044
uniprot entry name :
CBS_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-561
sequence :
PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVW
IRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILR
KIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDR
ISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAV
KGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDS
PESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAE
EILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKI
IGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLD
RAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMA
VAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQK
GFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDT
IAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKV
RPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVV
HEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAI
DLLNFVAAREQTQT
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products description :
Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury
products references :
The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.
Science 309:1559-1563(2005)
ncbi acc num :
NP_001258282.1
ncbi gb acc num :
NM_001271353.1
ncbi mol weight :
65.47kD
ncbi pathways :
Amino Acid Metabolism Pathway (198416); Biosynthesis Of Amino Acids Pathway (790952); Biosynthesis Of Amino Acids Pathway (795174); Cysteine And Methionine Metabolism Pathway (104494); Cysteine And Methionine Metabolism Pathway (103421); Cysteine Biosynthesis, Homocysteine + Serine = Cysteine Pathway (421829); Cysteine Biosynthesis, Homocysteine + Serine = Cysteine Pathway (468303); Cysteine Formation From Homocysteine Pathway (1324445); Folic Acid Network Pathway (198383); Glutathione And One Carbon Metabolism Pathway (760633)
uniprot summary :
CBS: Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury. Defects in CBS are the cause of cystathionine beta- synthase deficiency (CBSD). CBSD is an enzymatic deficiency resulting in altered sulfur metabolism and homocystinuria. The clinical features of untreated homocystinuria due to CBS deficiency include myopia, ectopia lentis, mental retardation, skeletal anomalies resembling Marfan syndrome, and thromboembolic events. Light skin and hair can also be present. Biochemical features include increased urinary homocystine and methionine. Belongs to the cysteine synthase/cystathionine beta- synthase family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: EC 4.2.1.22; Amino Acid Metabolism - glycine, serine and threonine; Other Amino Acids Metabolism - selenoamino acid; Amino Acid Metabolism - cysteine and methionine; Lyase. Cellular Component: cytoplasm; cytosol; nucleus. Molecular Function: cystathionine beta-synthase activity; cysteine synthase activity; enzyme binding; heme binding; identical protein binding; lyase activity; metal ion binding; nitrite reductase (NO-forming) activity; oxygen binding; protein homodimerization activity; pyridoxal phosphate binding; ubiquitin protein ligase binding. Biological Process: amino acid biosynthetic process; blood vessel remodeling; cerebellum morphogenesis; cysteine biosynthetic process; cysteine biosynthetic process from serine; cysteine biosynthetic process via cystathionine; endochondral ossification; homocysteine metabolic process; maternal process involved in pregnancy; negative regulation of apoptosis; regulation of blood vessel size; regulation of cGMP metabolic process; regulation of JNK activity; response to folic acid; superoxide metabolic process; transsulfuration