catalog number :
MBS1365325
products type :
Recombinant Protein
products full name :
Recombinant Human RNA-binding protein 14 (RBM14)
products short name :
[RNA-binding protein 14 (RBM14)]
products name syn :
[RNA-binding protein 14; Paraspeckle protein 2; PSP2; RNA-binding motif protein 14; RRM-containing coactivator activator/modulator; Synaptotagmin-interacting protein; SYT-interacting protein]
other names :
[RNA-binding protein 14 isoform 2; RNA-binding protein 14; RNA-binding protein 14; paraspeckle protein 2; SYT-interacting protein; transmembrane protein 137; synaptotagmin-interacting protein; RRM-containing coactivator activator/modulator; RNA binding motif protein 14; Paraspeckle protein 2; PSP2; RNA-binding motif protein 14; RRM-containing coactivator activator/modulator; Synaptotagmin-interacting protein; SYT-interacting protein]
products gene name :
[RBM14]
products gene name syn :
[RBM14; SIP]
other gene names :
[RBM14; RBM14; SIP; COAA; PSP2; SYTIP1; TMEM137; SIP; PSP2; SYT-interacting protein]
uniprot entry name :
RBM14_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-669aa; Full Length]
sequence :
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAF
VHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNT
WKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFV
HMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPG
LAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNST
GGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQP
ATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASY
RAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSA
SALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQ
AASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAA
SSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQP
AAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQ
TQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQ
PSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGN
AYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPR
ASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSF
RRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHS
GYQRRM
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
products description :
Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.
ncbi acc num :
NP_001185765.1
ncbi gb acc num :
NM_001198836.1
ncbi mol weight :
37,035 Da
ncbi summary :
This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene. [provided by RefSeq, Oct 2011]
uniprot summary :
RBM14: an RNA binding protein and transcriptional regulator. Expressed in all tissues tested, including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes. Two alternatively spliced isoforms have been observed. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1. Protein type: Nuclear receptor co-regulator; Nucleolus; RNA-binding. Chromosomal Location of Human Ortholog: 11q13.2. Cellular Component: nucleoplasm; transcription factor complex; nucleolus; Srb-mediator complex; ribonucleoprotein complex. Molecular Function: protein binding, bridging; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; RNA binding; nucleotide binding. Biological Process: transcription from RNA polymerase II promoter; estrogen receptor signaling pathway; glucocorticoid receptor signaling pathway; response to hormone stimulus; positive regulation of transcription from RNA polymerase II promoter; histone deacetylation; DNA replication; DNA repair; DNA recombination
size2 :
0.05 mg (Baculovirus)
size4 :
0.05 mg (Mammalian-Cell)
size6 :
0.1 mg (Baculovirus)
size7 :
0.5 mg (Baculovirus)
size8 :
0.1 mg (Mammalian-Cell)
size10 :
1 mg (Baculovirus)