product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Target of rapamycin complex 2 subunit MAPKAP1
catalog :
MBS1364264
quantity :
0.05 mg (E-Coli)
price :
170 USD
more info or order :
product information
catalog number :
MBS1364264
products type :
Recombinant Protein
products full name :
Recombinant Human Target of rapamycin complex 2 subunit MAPKAP1
products short name :
Target of rapamycin complex 2 subunit MAPKAP1
products name syn :
Mitogen-activated protein kinase 2-associated protein 1; Stress-activated map kinase-interacting protein 1; SAPK-interacting protein 1; mSIN1
other names :
target of rapamycin complex 2 subunit MAPKAP1 isoform 1; Target of rapamycin complex 2 subunit MAPKAP1; target of rapamycin complex 2 subunit MAPKAP1; mitogen-activated protein kinase associated protein 1; Mitogen-activated protein kinase 2-associated protein 1; Stress-activated map kinase-interacting protein 1; SAPK-interacting protein 1; mSIN1
products gene name :
MAPKAP1
other gene names :
MAPKAP1; MAPKAP1; MIP1; SIN1; JC310; SIN1b; SIN1g; MIP1; SIN1; TORC2 subunit MAPKAP1; SAPK-interacting protein 1; mSIN1
uniprot entry name :
SIN1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-522
sequence length :
522
sequence :
AFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEK
IHPPSMPGDSGSEIQGSNGETQGYVYAQSVDITSSWDFG
IRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQ
ELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPF
NEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVV
TMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIA
EDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLT
SKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRK
GSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCLV
RENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMI
HRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPI
SIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFE
SDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRR
TSFSFQKEKKSGQQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Signal Transduction
products description :
Subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'. Within mTORC2, MAPKAP1 is required for complex formation and mTORC2 kinase activity. MAPKAP1 inhibits MAP3K2 by preventing its dimerization and autophosphorylation. Inhibits HRAS and KRAS signaling. Enhances osmotic stress-induced phosphorylation of ATF2 and ATF2-mediated transcription. Involved in ciliogenesis, regulates cilia length through its interaction with CCDC28B independently of mTORC2 complex.
products references :
Alternative polyadenylation and splicing of mRNAs transcribed from the human Sin1 gene." Schroder W., Cloonan N., Bushell G., Sculley T. Gene 339:17-23(2004)
ncbi gi num :
56788407
ncbi acc num :
NP_001006618.1
ncbi gb acc num :
NM_001006617.1
uniprot acc num :
Q9BPZ7
ncbi mol weight :
74.95kD
ncbi pathways :
Adaptive Immune System Pathway (1269171); CD28 Co-stimulation Pathway (1269178); CD28 Dependent PI3K/Akt Signaling Pathway (1269179); CXCR3-mediated Signaling Events Pathway (138011); CXCR4-mediated Signaling Events Pathway (137910); Class I PI3K Signaling Events Mediated By Akt Pathway (138020); Constitutive Signaling By AKT1 E17K In Cancer Pathway (1268881); Costimulation By The CD28 Family Pathway (1269177); DAP12 Interactions Pathway (1269283); DAP12 Signaling Pathway (1269284)
ncbi summary :
This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
Sin1: a member of a conserved family of proteins that have an essential roles in signal transduction from yeast to mammals. An essential component of the mTORC2 complex, which consists of mTOR, LST8, Sin1, Protor (PRR5), and RICTOR, the Rapamycin Insensitive Companion of mTOR. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 regulates the phosphorylation of SGK1 S422 and PKCA S657. Enhances osmotic stress-induced phosphorylation of ATF2 and ATF2-mediated transcription. Contains a Ras-binding (RBD) and a pleckstrin homology (PH) domains. Plays an important role in the SAPK signaling pathway by binding directly to both ATF-2 and p38. A genetic knockout of Sin1 abolished Akt-S473 phosphorylation and disrupts the RICTOR-mTOR interaction, but Akt-Thr308 phosphorylation is maintained. Six alternatively-spliced isoforms of the human protein have been reported. All isoforms except 4 can be incorporated into the the mTORC2 complex. Protein type: Adaptor/scaffold. Chromosomal Location of Human Ortholog: 9q33.3. Cellular Component: cytoplasm; cytoplasmic membrane-bound vesicle; cytosol; Golgi apparatus; nucleoplasm; nucleus; plasma membrane; TORC2 complex. Molecular Function: phosphatidylinositol-3,4,5-triphosphate binding; phosphatidylinositol-3,4-bisphosphate binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding; protein kinase binding; Ras GTPase binding. Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; innate immune response; negative regulation of Ras protein signal transduction; nerve growth factor receptor signaling pathway; phosphoinositide-mediated signaling; substantia nigra development; T cell costimulation; vascular endothelial growth factor receptor signaling pathway
size1 :
0.05 mg (E-Coli)
price1 :
170 USD
size2 :
0.2 mg (E-Coli)
price2 :
395
size3 :
0.5 mg (E-Coli)
price3 :
640
size4 :
1 mg (E-Coli)
price4 :
1000
size5 :
0.05 mg (Baculovirus)
price5 :
1310
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!