product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Histone H2A.V
catalog :
MBS1363667
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1363667
products type :
Recombinant Protein
products full name :
Recombinant Human Histone H2A.V
products short name :
Histone H2A.V
products name syn :
H2A.F/Z
other names :
Histone H2A.V; histone H2A.V; H2A histone family member V; H2A.F/Z
products gene name :
H2AFV
other gene names :
H2AFV; H2AFV; H2AV; H2A.Z-2; H2AV
uniprot entry name :
H2AV_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-128; Full length
sequence length :
128
sequence :
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKT
RTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKS
LIGKKGQQKTA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products description :
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division
products references :
Precise characterization of human histones in the H2A gene family by top down mass spectrometry." Boyne M.T. II, Pesavento J.J., Mizzen C.A., Kelleher N.L. J. Proteome Res. 5:248-253(2006)
ncbi acc num :
NP_036544.1
uniprot acc num :
Q71UI9
ncbi mol weight :
29.5kD
ncbi pathways :
Alcoholism Pathway (585563); Alcoholism Pathway (587116); Systemic Lupus Erythematosus Pathway (83122); Systemic Lupus Erythematosus Pathway (534)
ncbi summary :
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq, Oct 2015]
uniprot summary :
H2AFV: Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division. Belongs to the histone H2A family. 2 isoforms of the human protein are produced by alternative splicing. Chromosomal Location of Human Ortholog: 7p13. Cellular Component: nuclear chromatin; nucleosome; nucleus. Molecular Function: DNA binding; protein heterodimerization activity. Biological Process: chromatin silencing
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
865
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1090
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!