product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Interleukin-26 (IL26)
catalog :
MBS1362134
quantity :
0.05 mg (E-Coli)
price :
260 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1362134
products type :
Recombinant Protein
products full name :
Recombinant Human Interleukin-26 (IL26)
products short name :
Interleukin-26 (IL26)
products name syn :
Interleukin-26; IL-26; Protein AK155
other names :
interleukin-26; Interleukin-26; interleukin-26; interleukin 26; Protein AK155
products gene name :
IL26
products gene name syn :
IL26; AK155
other gene names :
IL26; IL26; AK155; IL-26; AK155; IL-26
uniprot entry name :
IL26_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-171, Mature full length protein.
sequence length :
171
sequence :
KHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDR
IKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQL
QGCKKIRFVEDFHSLRQKLSHCISCASSAREMKSITRMK
RIFYRIGNKGIYKAISELDILLSWIKKLLESSQ
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
products description :
May play a role in local mechanisms of mucosal immunity and seems to have a proinflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alpha and IL-8, secretion of IL-8 and IL-10 and surface expression of ICAM1. Decreases proliferation of intestinal epithelial cells. Is inhibited by heparin.
ncbi gi num :
8923756
ncbi acc num :
NP_060872.1
ncbi gb acc num :
NM_018402.1
uniprot acc num :
Q9NPH9
ncbi mol weight :
20kD
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Jak-STAT Signaling Pathway (83077); Jak-STAT Signaling Pathway (488)
ncbi summary :
This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to contribute to the transformed phenotype of T cells after infection by herpesvirus samimiri. [provided by RefSeq, Jul 2008]
uniprot summary :
IL26: May play a role in local mechanisms of mucosal immunity and seems to have a proinflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alpha and IL-8, secretion of IL-8 and IL-10 and surface expression of ICAM1. Decreases proliferation of intestinal epithelial cells. Is inhibited by heparin. Belongs to the IL-10 family. Protein type: Secreted; Secreted, signal peptide; Cytokine. Chromosomal Location of Human Ortholog: 12q15. Cellular Component: extracellular space; cytosol. Molecular Function: cytokine activity. Biological Process: positive regulation of protein kinase B signaling cascade; cell-cell signaling; positive regulation of JAK-STAT cascade; positive regulation of transcription from RNA polymerase II promoter; immune response; inflammatory response; positive regulation of stress-activated MAPK cascade; negative regulation of epithelial cell proliferation; positive regulation of cytokine secretion
size1 :
0.05 mg (E-Coli)
price1 :
260 USD
size2 :
0.2 mg (Yeast)
price2 :
600
size3 :
0.05 mg (Baculovirus)
price3 :
890
size4 :
0.5 mg (E-Coli)
price4 :
890
size5 :
0.5 mg (Yeast)
price5 :
950
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!