product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Putative phospholipase B-like 2
catalog :
MBS1357625
quantity :
0.05 mg (Yeast)
price :
190 USD
more info or order :
product information
catalog number :
MBS1357625
products type :
Recombinant Protein
products full name :
Recombinant Rat Putative phospholipase B-like 2
products short name :
Putative phospholipase B-like 2
products name syn :
LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2
other names :
putative phospholipase B-like 2; Putative phospholipase B-like 2; putative phospholipase B-like 2; phospholipase B domain containing 2; LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2
products gene name :
Plbd2
other gene names :
Plbd2; Plbd2; P76
uniprot entry name :
PLBL2_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
36-585, Mature full length protein.
sequence length :
585
sequence :
GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYG
FHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYA
AGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLK
SFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDS
YEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTN
TKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRI
IKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDF
YILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIV
ANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNG
PSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIP
YFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSL
VEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISA
RSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSM
LAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVK
VPWD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Putative phospholipase.
products references :
Genome sequence of the Brown Norway rat yields insights into mammalian evolution.Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M., Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.Nature 428:493-521(2004) Expression profile of cardiovascular complications in type 2 diabetes.Zhang F.L., Ye C.Z., Xie C., Li G., Luo M. Lubec G., Kang S.U., Lubec S.Submitted (SEP-2007) to UniProtKB Biochemical characterization and lysosomal localization of the mannose-6-phosphate protein p76 (hypothetical protein LOC196463) .Jensen A.G., Chemali M., Chapel A., Kieffer-Jaquinod S., Jadot M., Garin J., Journet A.Biochem. J. 402:449-458(2007)
ncbi gi num :
158341628
ncbi acc num :
NP_640348.2
ncbi gb acc num :
NM_139255.3
uniprot acc num :
Q4QQW8
ncbi mol weight :
77.9kD
ncbi summary :
human homolog is a nucleolar RNA-binding protein [RGD, Feb 2006]
size1 :
0.05 mg (Yeast)
price1 :
190 USD
size2 :
0.05 mg (E-Coli)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!