Recombinant Human C-type lectin domain family 4 member C | MyBioSource MBS1353819 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human C-type lectin domain family 4 member C

catalog :

MBS1353819

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1353819

products type :

Recombinant Protein

products full name :

Recombinant Human C-type lectin domain family 4 member C

products short name :

C-type lectin domain family 4 member C

products name syn :

Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303

other names :

C-type lectin domain family 4 member C isoform 1; C-type lectin domain family 4 member C; C-type lectin domain family 4 member C; C-type lectin domain family 4 member C; Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD_antigen: CD303

products gene name :

CLEC4C

other gene names :

CLEC4C; CLEC4C; DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; BDCA-2

uniprot entry name :

CLC4C_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

45-213, partial, provide the complete extracellular domain.

sequence length :

213

sequence :

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCC
PTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVIN
TREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPY
NENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHV
PQKSICKMKKIYI

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.

products references :

Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells.Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.3.0.CO;2-X>Eur. J. Immunol. 31:2733-2740(2001) BDCA-2, a novel plasmacytoid dendritic cell-specific type II C-type lectin, mediates antigen capture and is a potent inhibitor of interferon alpha/beta induction.Dzionek A., Sohma Y., Nagafune J., Cella M., Colonna M., Facchetti F., Gunther G., Johnston I., Lanzavecchia A., Nagasaka T., Okada T., Vermi W., Winkels G., Yamamoto T., Zysk M., Yamaguchi Y., Schmitz J.J. Exp. Med. 194:1823-1834(2001) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003)

ncbi gi num :

18466806

ncbi acc num :

NP_569708.1

ncbi gb acc num :

NM_130441.2

uniprot acc num :

Q8WTT0

ncbi mol weight :

35.94kD

ncbi pathways :

C-type Lectin Receptors (CLRs) Pathway (1269303); Dectin-2 Family Pathway (1269308); Immune System Pathway (1269170); Innate Immune System Pathway (1269203)

ncbi summary :

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

uniprot summary :

CLEC4C: Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein- tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: 12p13.2-p12.3. Cellular Component: integral to membrane; plasma membrane. Molecular Function: carbohydrate binding. Biological Process: adaptive immune response; innate immune response; stimulatory C-type lectin receptor signaling pathway

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

255

size3 :

0.02 mg (Mammalian-Cell)

price3 :

295

size4 :

0.2 mg (E-Coli)

price4 :

460

size5 :

0.05 mg (Mammalian-Cell)

price5 :

575

more info or order :

MyBioSource product webpage