CQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNG
GQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCR
NGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRP
CANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPC
QRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVG
TPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQES
GLGESS

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Staphylococcus aureus (strain N315) Staphylococcal complement inhibi ...
- Recombinant Human Dickkopf-related protein 2 | MBS1341887
- Recombinant Human Sialic acid-binding Ig-like lectin 15 | MBS1350503
- Recombinant Mouse Wiskott-Aldrich syndrome protein family member 2 (Wasf2)
- Recombinant Human C-type lectin domain family 4 member C | MBS1353819