catalog number :
MBS1333485
products type :
Recombinant Protein
products full name :
Recombinant Mouse Thioredoxin domain-containing protein 12
products short name :
Thioredoxin domain-containing protein 12
products name syn :
Endoplasmic reticulum resident protein 19; ER protein 19; ERp19; Thioredoxin-like protein p19
other names :
thioredoxin domain-containing protein 12; Thioredoxin domain-containing protein 12; thioredoxin domain-containing protein 12; thioredoxin domain containing 12 (endoplasmic reticulum); Endoplasmic reticulum resident protein 19; ER protein 19; ERp19; Thioredoxin-like protein p19
products gene name :
Txndc12
other gene names :
Txndc12; Txndc12; ERp16; ERp19; 0610040B21Rik; Tlp19; ER protein 19; ERp19
uniprot entry name :
TXD12_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-170
sequence :
RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSW
CGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDED
FSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVS
AEQVVQGMKEAQERLTGDAFREKHFQDEL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products description :
Possesses significant protein thiol-disulfide oxidase activity.
products references :
ERp19 and ERp46, new members of the thioredoxin family of endoplasmic reticulum proteins."
Knoblach B., Keller B.O., Groenendyk J., Aldred S., Zheng J., Lemire B.D., Li L., Michalak M.
Mol. Cell. Proteomics 2:1104-1119(2003)
ncbi acc num :
NP_079610.1
ncbi gb acc num :
NM_025334.3
ncbi mol weight :
20.58kD
ncbi pathways :
Glutathione Metabolism Pathway (83172); Glutathione Metabolism Pathway (343)
uniprot summary :
TXNDC12: Possesses significant protein thiol-disulfide oxidase activity. Protein type: Secreted, signal peptide; Other Amino Acids Metabolism - glutathione; Secreted; EC 1.8.4.2; Oxidoreductase. Cellular Component: endoplasmic reticulum; endoplasmic reticulum lumen. Molecular Function: oxidoreductase activity; peptide disulfide oxidoreductase activity; protein-disulfide reductase (glutathione) activity. Biological Process: cell redox homeostasis