product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Methylcytosine dioxygenase TET2 (Tet2) , partial
catalog :
MBS1330723
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1330723
products type :
Recombinant Protein
products full name :
Recombinant Mouse Methylcytosine dioxygenase TET2 (Tet2) , partial
products short name :
[Methylcytosine dioxygenase TET2 (Tet2)]
other names :
[methylcytosine dioxygenase TET2 isoform 1; Methylcytosine dioxygenase TET2; methylcytosine dioxygenase TET2; tet methylcytosine dioxygenase 2; Protein Ayu17-449]
products gene name :
[Tet2]
products gene name syn :
[Tet2]
other gene names :
[Tet2; Tet2; Ayu17-449; mKIAA1546; E130014J05Rik; Kiaa1546]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1810-1912. Fragment at the C-terminal.]
sequence length :
1912
sequence :
RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKN
GSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGS
VTTDSTVTTSPYAFTQVTGPYNTFV
purity :
>85% (SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mouse
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol
ncbi gi num :
157057152
ncbi acc num :
NP_001035490.2
ncbi gb acc num :
NM_001040400.2
uniprot acc num :
Q4JK59
ncbi mol weight :
64,499 Da
ncbi pathways :
Epigenetic Regulation Of Gene Expression Pathway (1367459); Gene Expression Pathway (1367365); TET1,2,3 And TDG Demethylate DNA Pathway (1367461)
uniprot summary :
Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also mediates subsequent conversion of 5hmC into 5-formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC). Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Methylation at the C5 position of cytosine bases is an epigenetic modification of the mammalian genome which plays an important role in transcriptional regulation. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT.
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!