catalog number :
MBS1330158
products type :
Recombinant Protein
products full name :
Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial
products short name :
[MORC family CW-type zinc finger protein 3 (MORC3), partial]
products name syn :
[MORC family CW-type zinc finger protein 3; Zinc finger CW-type coiled-coil domain protein 3]
other names :
[MORC family CW-type zinc finger protein 3; MORC family CW-type zinc finger protein 3; MORC family CW-type zinc finger protein 3; nuclear matrix protein NXP2; zinc finger, CW type with coiled-coil domain 3; zinc finger, CW-type with coiled-coil domain 3; zinc finger CW-type coiled-coil domain protein 3; MORC family CW-type zinc finger 3; Zinc finger CW-type coiled-coil domain protein 3]
products gene name :
[MORC3]
products gene name syn :
[MORC3; KIAA0136; ZCWCC3]
other gene names :
[MORC3; MORC3; NXP2; ZCW5; ZCWCC3; KIAA0136; ZCWCC3]
uniprot entry name :
MORC3_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-290aa; Partial]
sequence :
MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDN
AYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLH
KMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIV
FTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQM
INLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTR
IIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGY
KKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKV
KTQLVSKSLAYIERDVY
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Homo sapiens (Human)
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233).
ncbi acc num :
NP_056173.1
ncbi gb acc num :
NM_015358.2
ncbi mol weight :
107,113 Da
ncbi summary :
This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled-coil domain. [provided by RefSeq, Jul 2008]
uniprot summary :
MORC3: . Protein type: Cell cycle regulation; RNA-binding. Chromosomal Location of Human Ortholog: 21q22.13. Cellular Component: nucleoplasm; intermediate filament cytoskeleton; PML body. Molecular Function: zinc ion binding. Biological Process: peptidyl-serine phosphorylation; protein stabilization; negative regulation of fibroblast proliferation; cell aging; maintenance of protein localization in nucleus; protein amino acid phosphorylation; post-embryonic development