product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Fc receptor-like protein 4
catalog :
MBS1327975
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1327975
products type :
Recombinant Protein
products full name :
Recombinant Human Fc receptor-like protein 4
products short name :
Fc receptor-like protein 4
products name syn :
Fc receptor homolog 4; FcRH4; IFGP family protein 2; hIFGP2; Immune receptor translocation-associated protein 1; CD_antigen: CD307d
other names :
Fc receptor-like protein 4; Fc receptor-like protein 4; Fc receptor-like protein 4; Fc receptor like 4; Fc receptor homolog 4; FcRH4; IFGP family protein 2; hIFGP2; Immune receptor translocation-associated protein 1; CD_antigen: CD307d
products gene name :
FCRL4
other gene names :
FCRL4; FCRL4; FCRH4; IGFP2; IRTA1; CD307d; FCRH4; IFGP2; IRTA1; FcR-like protein 4; FcRL4; FcRH4; hIFGP2
uniprot entry name :
FCRL4_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-387
sequence length :
515
sequence :
AHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWY
HRHYWGEKLTLTPGNTLEVRESGLYRCQARGSPRSNPVR
LLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKY
TWNGNILSISNKSWDLLIPQASSNNNGNYRCIGYGDEND
VFRSNFKIIKIQELFPHPELKATDSQPTEGNSVNLSCET
QLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWR
ENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLE
TQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQES
LGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQS
MVLNVTVRETPGNRDGL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Immunology
products description :
May function as an inhibitor of the B-cell receptor signaling. May function in the B-cell-mediated immune response.
products references :
IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy." Hatzivassiliou G., Miller I., Takizawa J., Palanisamy N., Rao P.H., Iida S., Tagawa S., Taniwaki M., Russo J., Neri A., Cattoretti G., Clynes R., Mendelsohn C., Chaganti R.S.K., Dalla-Favera R. Immunity 14:277-289(2001)
ncbi gi num :
14550416
ncbi acc num :
NP_112572.1
ncbi gb acc num :
NM_031282.2
uniprot acc num :
Q96PJ5
ncbi mol weight :
57.57kD
ncbi summary :
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains three immune-receptor tyrosine-based inhibitory motifs. This protein may play a role in the function of memory B-cells in the epithelia. Aberrations in the chromosomal region encoding this gene are associated with non-Hodgkin lymphoma and multiple myeloma. [provided by RefSeq, Apr 2009]
uniprot summary :
FCRL4: May function as an inhibitor of the B-cell receptor signaling. May function in the B-cell-mediated immune response. A chromosomal aberration involving FCRL4 is found in non-Hodgkin lymphoma (NHG). Translocation t(1;1)(p36.3; q21.1-2). A chromosomal aberration involving FCRL4 is found in multiple myeloma (MM). Translocation t(1;14)(q21;q32) that forms a FCRL4-IGHA1 fusion protein. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral. Chromosomal Location of Human Ortholog: 1q21. Cellular Component: integral to membrane; plasma membrane. Molecular Function: protein binding. Biological Process: adaptive immune response
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.01 mg (Yeast)
price2 :
125
size3 :
0.05 mg (E-Coli)
price3 :
190
size4 :
0.05 mg (Yeast)
price4 :
220
size5 :
0.02 mg (Mammalian-Cell)
price5 :
295
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!